Advanced Search (OLGA)

Gene: Pebp4 (phosphatidylethanolamine binding protein 4) Rattus norvegicus

Analyze

Symbol:

Pebp4

Name:

phosphatidylethanolamine binding protein 4

RGD ID:

1593295

Description:

Orthologous to human PEBP4 (phosphatidylethanolamine binding protein 4); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; amitrole.

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

AABR07018326.1; LOC691997; phosphatidylethanolamine-binding protein 4; similar to PEBP family protein precursor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

Pebp4^{Tn(sb-T2/Bart3)2.299Mcwi}

Genetic Models:

F344-Pebp4^{Tn(sb-T2/Bart3)2.299Mcwi}

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	51,328,127 - 51,543,920 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	51,331,690 - 51,543,899 (+)	Ensembl				GRCr8
mRatBN7.2	15	44,920,946 - 45,134,188 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	44,921,886 - 45,134,191 (+)	Ensembl				mRatBN7.2
Rnor_6.0	15	51,644,948 - 51,740,626 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0	15	51,528,587 - 51,615,204 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	51,528,514 - 51,740,281 (+)	NCBI			rn6	Rnor6.0
Rnor_5.0	15	55,252,902 - 55,466,149 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	50,225,405 - 50,460,627 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	44,602,584 - 44,814,601 (+)	NCBI		Celera
Cytogenetic Map	15	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2-palmitoylglycerol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

amitrole (EXP)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

CGP 52608 (ISO)

copper atom (EXP)

copper(0) (EXP)

doxorubicin (ISO)

fulvestrant (ISO)

hydralazine (ISO)

methimazole (EXP)

paracetamol (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

Tesaglitazar (EXP)

testosterone (ISO)

toluene (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:21873635	PMID:23533145

Genomics

Comparative Map Data

Pebp4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	51,328,127 - 51,543,920 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	51,331,690 - 51,543,899 (+)	Ensembl				GRCr8
mRatBN7.2	15	44,920,946 - 45,134,188 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	44,921,886 - 45,134,191 (+)	Ensembl				mRatBN7.2
Rnor_6.0	15	51,644,948 - 51,740,626 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0	15	51,528,587 - 51,615,204 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	51,528,514 - 51,740,281 (+)	NCBI			rn6	Rnor6.0
Rnor_5.0	15	55,252,902 - 55,466,149 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	50,225,405 - 50,460,627 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	44,602,584 - 44,814,601 (+)	NCBI		Celera
Cytogenetic Map	15	p11	NCBI

PEBP4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	22,713,251 - 22,941,077 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	22,713,237 - 23,000,000 (-)	Ensembl			hg38	GRCh38
GRCh37	8	22,570,764 - 22,798,590 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	22,626,710 - 22,841,366 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	8	21,533,122 - 21,747,804 (-)	NCBI		Celera
Cytogenetic Map	8	p21.3	NCBI
HuRef	8	21,113,907 - 21,329,903 (-)	NCBI		HuRef
CHM1_1	8	22,773,101 - 22,987,671 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	22,987,819 - 23,216,048 (-)	NCBI		T2T-CHM13v2.0

Pebp4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	70,077,856 - 70,297,367 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	70,077,869 - 70,297,367 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	69,840,407 - 70,059,918 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	69,840,420 - 70,059,918 (+)	Ensembl			mm10	GRCm38
MGSCv37	14	70,240,227 - 70,459,693 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	68,575,487 - 68,794,959 (+)	NCBI		MGSCv36	mm8
Celera	14	67,378,541 - 67,600,399 (+)	NCBI		Celera
Cytogenetic Map	14	D2	NCBI
cM Map	14	36.1	NCBI

Pebp4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	46,125,150 - 46,333,200 (-)	Ensembl
ChiLan1.0	NW_004955403	46,126,263 - 46,317,830 (-)	NCBI	ChiLan1.0	ChiLan1.0

PEBP4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	41,218,356 - 41,505,203 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	16,945,744 - 17,232,411 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	21,963,297 - 22,250,024 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	18,902,616 - 19,117,229 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	18,902,734 - 19,117,025 (-)	Ensembl			panPan2	panpan1.1

PEBP4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	34,329,160 - 34,574,086 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	34,317,421 - 34,574,066 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	34,917,144 - 35,164,286 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	34,536,708 - 34,784,007 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	34,535,120 - 34,784,085 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	34,483,438 - 34,730,274 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	34,337,758 - 34,584,606 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	34,492,754 - 34,740,068 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Pebp4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404943	11,922,656 - 12,137,275 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936555	6,433,237 - 6,620,072 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936555	6,433,243 - 6,648,014 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PEBP4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	6,966,862 - 7,173,347 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	6,966,861 - 7,173,255 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	7,446,928 - 7,543,617 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Sscrofa10.2	14	7,691,260 - 7,698,221 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PEBP4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	20,792,718 - 21,066,746 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	20,792,707 - 21,004,134 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666052	21,223,048 - 21,434,545 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pebp4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624758	18,203,239 - 18,394,891 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Pebp4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	12	54,287,483 - 54,492,144 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Pebp4
1831 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	145
Count of miRNA genes:	131
Interacting mature miRNAs:	139
Transcripts:	ENSRNOT00000039454
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300144	Rf23	Renal function QTL 23	3.61		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	15	44806773	104695021	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2315759	53331089	Rat
152025253	Hrtrt24	Heart rate QTL 24	3.82		heart pumping trait (VT:2000009)		15	31855803	92671517	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	43677244	88677244	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	28527732	73527732	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	43677244	88677244	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	25285835	104695021	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	22336351	52597086	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	25285835	104695021	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	19155762	87086765	Rat
1598828	Glom14	Glomerulus QTL 14	2.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	15	40463152	85463152	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	14926594	71614418	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	22336351	67336351	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	43677244	88677244	Rat
2306968	Anxrr23	Anxiety related response QTL 23	4.83		reflex trait (VT:0001961)	amplitude of the acoustic startle response (CMO:0001520)	15	44806773	52597086	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	43677244	88677244	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	25285835	104695021	Rat
7411725	Strs7	Sensitivity to stroke QTL 7	3.8		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	15	44465447	56583797	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	43677244	88677244	Rat

Markers in Region

28.MMHAP16FRB10.seq

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	45,054,716 - 45,054,885 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	51,660,824 - 51,660,992	NCBI	Rnor6.0
Rnor_5.0	15	55,386,302 - 55,386,470	UniSTS	Rnor5.0
RGSC_v3.4	15	50,381,198 - 50,381,366	UniSTS	RGSC3.4
Celera	15	44,734,796 - 44,734,964	UniSTS
Cytogenetic Map	15	p11	UniSTS

D17S1860

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	45,133,859 - 45,134,514 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	51,739,958 - 51,740,612	NCBI	Rnor6.0
Rnor_5.0	15	55,465,805 - 55,466,459	UniSTS	Rnor5.0
RGSC_v3.4	15	50,460,302 - 50,460,956	UniSTS	RGSC3.4
Celera	15	44,813,933 - 44,814,587	UniSTS
Cytogenetic Map	15	p11	UniSTS

Genetic Models

This gene Pebp4 is modified in the following models/strains:

F344-Pebp4^{Tn(sb-T2/Bart3)2.299Mcwi}

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

circulatory system	ectoderm	hemolymphoid system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	sensory system	visual system
11	41	13	45	25	1	49	20	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_008769892	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008770836	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017599905	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039093942	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063274888	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000093193 ⟹ ENSRNOP00000095653

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	51,331,690 - 51,543,899 (+)	Ensembl
mRatBN7.2 Ensembl	15	44,921,886 - 45,134,191 (+)	Ensembl

RefSeq Acc Id:

XM_008770836 ⟹ XP_008769058

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	51,328,127 - 51,543,920 (+)	NCBI
mRatBN7.2	15	44,920,954 - 45,134,188 (+)	NCBI
Rnor_6.0	15	51,644,948 - 51,740,626 (+)	NCBI

Sequence:

show sequence

TTCTCATCGGATTTATTTCTACATCAAGGCCAAGAGTCCTATTGACTCTTTCACAGACTTCGTT
TTTCTGAGAGTAAGCATGCAACATGAGAAAATCCCATGAGTGTCAGACAAAAGCAGGTAGGATG
CAGTAGGCACCGGACTGGCGTCTCAGCTGGAAACAGGGAGTAAAGTCTTCTCTTTTGGTACTGT
TCTGTCAAGTGCCAGGCACGGTGTTACATTACTTCTTGATGCATGTGTACAGGGTGCACAGTAT
CTGCTGGTGATGGTGATCCAGATGCCCCCAGCAGTCTAATCCCAGGATGAAATACTGGAGACAC
TGGTGGTGTCCAACATCACAGGCACTGACATGAAAAGCGGGAGCATCCGTGGCAATATAATAAC
AGACTACCAGCCTCCTACCCCACCGCCGACCACTGGTCTACACCGCTACCAGTTCTTTGTCTAC
CTTCAGGGAGACAGAGACATTTCTATCCCAGAAAGTGAAAACGAAAACCGAGGTGCTTGGAAAC
TGGACAAATTTCTGCAGCAGTACGGGCTGCAAGATCCTGACACAAGCACCCAGTTCATGACTCA
GTTTGATGGGGAACTGCCACCAGATTTTGGTAGCATTAACGACGGCCAAGACCAACCCGATCAA
AGATAACTACTGTCCACTGAACTGAAACTTTTACCTTCCAGATGTGTGCTCATGTCGTATCATC
CACTACAGATGGTCTGGGGATAGAATCTCCTCTTGGCATCTTCCAAATAAAAATAAATAAATCA
ATCAATCAATCAAATAAATAAAACAAAAAAACAGAAACAAAAACAAAAACAAAAAACCACTCAC
CCAGGGCTTAGCAATTTGCTTTCTAACCTGTGTATTACTTTGAAAAACAGCAAGGGAAGGACTG
AGGAGATGGTACAGTCAATAAAGAGCTTGCCTTGCAAACATTAGGAACTGAGTTAGGATATCCG
GAACTCACGTAAAAAGCCCAGTTATGGGAAAATGAGAATCAGAGGCAAGCAGACCTTCAAAGGT
CACTGGCCAACGGTCTAGGCTACTTCGACAACTGGCCAATAAGAAACTCTGCCTTAGCCAGGCA
ACGGTGGTGCACACCTTTAGC

hide sequence

RefSeq Acc Id:

XM_039093942 ⟹ XP_038949870

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	51,328,127 - 51,543,818 (+)	NCBI
mRatBN7.2	15	44,920,946 - 45,134,044 (+)	NCBI

RefSeq Acc Id:

XM_063274888 ⟹ XP_063130958

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	51,328,127 - 51,543,920 (+)	NCBI

Protein Sequences


Protein RefSeqs	XP_008769058	(Get FASTA)	NCBI Sequence Viewer
	XP_038949870	(Get FASTA)	NCBI Sequence Viewer
	XP_063130958	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM02197	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000095653
	ENSRNOP00000095653.1

RefSeq Acc Id:	XP_008769058 ⟸ XM_008770836
- Peptide Label:	isoform X1
- UniProtKB:	A6HTI3 (UniProtKB/TrEMBL), A0A8I6GL87 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKSGSIRGNIITDYQPPTPPPTTGLHRYQFFVYLQGDRDISIPESENENRGAWKLDKFLQQYGL QDPDTSTQFMTQFDGELPPDFGSINDGQDQPDQR hide sequence

RefSeq Acc Id:	XP_038949870 ⟸ XM_039093942
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6GL87 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000095653 ⟸ ENSRNOT00000093193

RefSeq Acc Id:	XP_063130958 ⟸ XM_063274888
- Peptide Label:	isoform X3

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1593295	AgrOrtholog
BioCyc Gene	G2FUF-13246	BioCyc
Ensembl Genes	ENSRNOG00000026247	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000093193	ENTREZGENE
	ENSRNOT00000093193.3	UniProtKB/TrEMBL
Gene3D-CATH	3.90.280.10	UniProtKB/TrEMBL
InterPro	PEBP	UniProtKB/TrEMBL
	PEBP-like_sf	UniProtKB/TrEMBL
	PEBP_euk	UniProtKB/TrEMBL
	Phosphatidylethanolamine-bd_CS	UniProtKB/TrEMBL
NCBI Gene	691997	ENTREZGENE
PANTHER	PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN 4	UniProtKB/TrEMBL
	PTHR11362	UniProtKB/TrEMBL
Pfam	PBP	UniProtKB/TrEMBL
PhenoGen	Pebp4	PhenoGen
PROSITE	PBP	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000026247	RatGTEx
Superfamily-SCOP	SSF49777	UniProtKB/TrEMBL
UniProt	A0A8I6GL87	ENTREZGENE, UniProtKB/TrEMBL
	A6HTI3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-06-02	Pebp4	phosphatidylethanolamine binding protein 4	AABR07018326.1		Data merged from RGD:15003630	737654	PROVISIONAL
2019-11-08	AABR07018326.1				Symbol and Name status set to provisional	45752	PROVISIONAL
2008-12-02	Pebp4	phosphatidylethanolamine binding protein 4	Pebp4	phosphatidylethanolamine-binding protein 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Pebp4	phosphatidylethanolamine-binding protein 4	LOC691997	similar to PEBP family protein precursor	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC691997	similar to PEBP family protein precursor	LOC684210	similar to PEBP family protein precursor	Data merged from RGD:1592735	1643240	APPROVED
2006-11-20	LOC691997	similar to PEBP family protein precursor			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC684210	similar to PEBP family protein precursor			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message