Advanced Search (OLGA)

Gene: Bloc1s3 (biogenesis of lysosomal organelles complex-1, subunit 3) Rattus norvegicus

Analyze

Symbol:

Bloc1s3

Name:

biogenesis of lysosomal organelles complex-1, subunit 3

RGD ID:

1591724

Description:

Predicted to enable protein transmembrane transporter activity. Predicted to be involved in several processes, including anterograde synaptic vesicle transport; endosome to melanosome transport; and melanosome transport. Predicted to act upstream of or within several processes, including positive regulation of natural killer cell activation; secretion of lysosomal enzymes; and vesicle organization. Predicted to be located in cytosol and transport vesicle. Predicted to be part of BLOC-1 complex. Human ortholog(s) of this gene implicated in Hermansky-Pudlak syndrome 8. Orthologous to human BLOC1S3 (biogenesis of lysosomal organelles complex 1 subunit 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; amphetamine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

biogenesis of lysosome-related organelles complex 1 subunit 3; biogenesis of lysosome-related organelles complex-1, subunit 3; LOC680476; similar to reduced pigmentation protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	88,283,864 - 88,286,244 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	88,280,115 - 88,294,060 (-)	Ensembl				GRCr8
mRatBN7.2	1	79,155,873 - 79,158,247 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	79,155,693 - 79,158,505 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	84,544,282 - 84,546,657 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	93,102,358 - 93,104,733 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	86,299,386 - 86,301,761 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	80,414,766 - 80,417,385 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	80,415,686 - 80,416,273 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	81,680,787 - 81,683,351 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	78,859,459 - 78,861,218 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	73,615,424 - 73,618,043 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Hermansky-Pudlak syndrome (ISO)

Hermansky-Pudlak syndrome 8 (ISO,ISS)

polycystic ovary syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

amphetamine (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

endosulfan (EXP)

enzyme inhibitor (ISO)

ethanol (ISO)

flusilazole (ISO)

FR900359 (ISO)

gentamycin (EXP)

hexaconazole (ISO)

leflunomide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (EXP,ISO)

N-methyl-4-phenylpyridinium (EXP)

nitrates (ISO)

okadaic acid (ISO)

paracetamol (ISO)

sodium arsenite (ISO)

thimerosal (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

triadimefon (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anterograde axonal transport (IEA,ISO)

anterograde synaptic vesicle transport (IEA,ISO)

biological_process (ND)

blood coagulation (ISO)

developmental pigmentation (ISO)

endosome to melanosome transport (IEA,ISO)

eye development (IEA,ISO)

melanosome organization (ISO)

melanosome transport (IEA,ISO)

pigmentation (IEA,ISO)

platelet activation (IEA,ISO)

platelet dense granule organization (ISO)

positive regulation of natural killer cell activation (ISO)

protein transmembrane transport (IEA)

response to xenobiotic stimulus (ISO)

secretion of lysosomal enzymes (ISO)

Cellular Component

axon cytoplasm (IEA)

BLOC-1 complex (IBA,IEA,ISO)

cytoplasm (IEA,ISO)

cytosol (IEA,ISO)

transport vesicle (IEA,ISO)

Molecular Function

protein binding (ISO)

protein transmembrane transporter activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:2513223	PMID:4031470	PMID:7069188	PMID:7089489	PMID:7203014	PMID:15102850	PMID:15265785	PMID:16385460	PMID:16837549	PMID:17182842	PMID:21998198	PMID:22203680

Genomics

Comparative Map Data

Bloc1s3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	88,283,864 - 88,286,244 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	88,280,115 - 88,294,060 (-)	Ensembl				GRCr8
mRatBN7.2	1	79,155,873 - 79,158,247 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	79,155,693 - 79,158,505 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	84,544,282 - 84,546,657 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	93,102,358 - 93,104,733 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	86,299,386 - 86,301,761 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	80,414,766 - 80,417,385 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	80,415,686 - 80,416,273 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	81,680,787 - 81,683,351 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	78,859,459 - 78,861,218 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	73,615,424 - 73,618,043 (-)	NCBI		Celera
Cytogenetic Map	1	q21	NCBI

BLOC1S3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	45,178,784 - 45,217,083 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	45,178,745 - 45,216,933 (+)	Ensembl			hg38	GRCh38
GRCh37	19	45,682,042 - 45,685,058 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	50,373,891 - 50,375,003 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	50,374,394 - 50,375,003	NCBI
Celera	19	42,486,265 - 42,489,320 (+)	NCBI		Celera
Cytogenetic Map	19	q13.32	NCBI
HuRef	19	42,112,149 - 42,115,204 (+)	NCBI		HuRef
CHM1_1	19	45,685,293 - 45,688,348 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	48,003,901 - 48,043,728 (+)	NCBI		T2T-CHM13v2.0

Bloc1s3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	19,239,708 - 19,242,295 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	19,238,411 - 19,242,292 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	19,505,783 - 19,508,380 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	19,504,486 - 19,508,367 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	20,091,153 - 20,093,680 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	18,664,326 - 18,666,853 (-)	NCBI		MGSCv36	mm8
Celera	7	16,911,731 - 16,914,258 (-)	NCBI		Celera
Cytogenetic Map	7	A3	NCBI
cM Map	7	9.92	NCBI

Bloc1s3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955555	2,184,490 - 2,185,138 (+)	Ensembl
ChiLan1.0	NW_004955555	2,183,752 - 2,186,154 (+)	NCBI	ChiLan1.0	ChiLan1.0

BLOC1S3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	51,312,338 - 51,340,776 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	53,184,333 - 53,212,207 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	42,100,227 - 42,128,636 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

BLOC1S3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	110,325,351 - 110,328,226 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	110,326,843 - 110,327,442 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	109,807,262 - 109,810,176 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	110,855,669 - 110,858,583 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	110,857,161 - 110,857,760 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	110,531,263 - 110,534,175 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	110,165,890 - 110,168,810 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	111,035,068 - 111,037,994 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Bloc1s3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	17,354,791 - 17,357,023 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936706	1,684,824 - 1,706,544 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936706	1,702,154 - 1,704,366 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BLOC1S3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	51,590,497 - 51,591,222 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	51,590,497 - 51,591,222 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

LOC103234853
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	38,623,639 - 38,642,217 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	38,639,659 - 38,640,261 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	18,225,491 - 18,258,815 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bloc1s3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	171,116,453 - 171,118,192 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Bloc1s3
13 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	31
Count of miRNA genes:	31
Interacting mature miRNAs:	31
Transcripts:	ENSRNOT00000023457
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	51940904	101229020	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	46302615	91302615	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	46302615	91302615	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	46302615	91302615	Rat
631512	Scl6	Serum cholesterol level QTL 6	9.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	81269860	99645535	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	46302615	91302615	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	65405637	96805205	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	51909206	91302615	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	58769992	103769992	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	46302615	91302615	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	46302615	91302615	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	43509952	88509952	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	46302615	91302615	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	43509952	88509952	Rat

Markers in Region

RH142672

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	79,156,035 - 79,156,157 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	80,414,963 - 80,415,084	NCBI	Rnor6.0
Rnor_5.0	1	81,680,984 - 81,681,105	UniSTS	Rnor5.0
RGSC_v3.4	1	78,859,656 - 78,859,777	UniSTS	RGSC3.4
Celera	1	73,615,621 - 73,615,742	UniSTS
RH 3.4 Map	1	818.2	UniSTS
Cytogenetic Map	1	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	91	90	59	92	59	6	356	192	11	140	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001401248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006223118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017589370	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017590002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023457 ⟹ ENSRNOP00000023457

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	88,283,749 - 88,286,025 (-)	Ensembl
mRatBN7.2 Ensembl	1	79,155,693 - 79,158,505 (-)	Ensembl
Rnor_6.0 Ensembl	1	80,415,686 - 80,416,273 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000163776 ⟹ ENSRNOP00000105524

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	88,280,115 - 88,294,060 (-)	Ensembl

RefSeq Acc Id:

NM_001401248 ⟹ NP_001388177

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	88,283,864 - 88,286,238 (-)	NCBI
mRatBN7.2	1	79,155,873 - 79,158,247 (-)	NCBI

RefSeq Acc Id:

XM_017590002 ⟹ XP_017445491

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	88,284,116 - 88,286,244 (-)	NCBI
mRatBN7.2	1	79,155,914 - 79,158,238 (-)	NCBI
Rnor_6.0	1	80,414,766 - 80,417,385 (-)	NCBI

Sequence:

show sequence

GTCTTCCGCCCTTACTTCGCTCCCCTCCCTGTTTCAGTCTTTGGACACCCGATTGGCTGAGCCC
CTGATTCGTGTGAGGATCCAGGTTTAAAAAAATAAATTCACGCGTTACACAAAATTTTCCTAAA
TAAACAAACAAATAAATAGGACCACAACACGGAAGCGACTTGTCTAGCCGCTTCCTTATTGGCC
AGACCTCGACTCACGTGACGCTACGCGAAGAGAACGCCTCACTTCCGCCAGGCGGCGGATCCCT
CGGGCTCGGAGCTTCGGAGACCGGGTATGGCCTTCCGAGACTCTGGTGTCGGTGGCTCTACTCC
GTGCCATGGCGTCGTCCCAAGGTCGGCGGAGAAGGCCGGGAACAGTGGTGCCCGGGGAAGCGGC
GGAGACCGACTCGGAGCTGTCTGCATCATCATCCGAGGAGGAGCTATACCTGGGTCCCTCGGGC
CCGACACGCGGCCGCCCCACTGGGTTGCGGGTGGCCGGGGAGGCGGCGGAGACCGACTCCGAGC
CTGAGCCGGAGCCCAGGGTCGCGCCGGGAGACCTGCCCCCCCTCGTGGTGCAACGGGATGCAGT
GGAGGCGTGGGGCACCGAGGAGACCCCTGTCCTAGCGCCTGCGCGCTCTCTGCTGCAGCTCAGG
TTGGCTGAGAGCCAGACGCGCCTGGACCACGACGTAGCGGCTGCGGTGAGCGGCGTGTACCGCC
GTGCGGGTCGCGATGTGGCCGCCCTGGCCGGGAGGCTGGCAGCTGCCCAGGCCATCGGGCTGGC
GGCCGCCCACAGCGTGCGCCTGGCGCGCGGAGACCTCTGCGCGCTTGCGGAGCGCCTGGATATT
GTGGCTGGTTGTCGCCTGCTGCCGGACATACGAGGGGTGCCGGGCATCGAGCCCGAGCAGGACC
CGGGACCGAGAGCCTAGGCTGTTACTCTGTGTCCCCCCCACCTGACTCTGCCTCTTGGTGGACA
TTAGTACCACCTGTGGCATCTGACTCTGTCTTTGTTCTTGGATCACCGAGGCCTCCAATTCGTA
CTAACGTTTGGTTAACGCCAACCGAAGCATCTTCGTTGGTTTGGCCCGATTAAATTCTTAGCAC
AATTCTGGGATCCCCAACCCAAGACTCGGCCCAGGTTCTGTGGCTATCAAGTGGTTTAGCCCCC
ACCCCTTCATTTTGGTCCTATTTCCTAAATTGAGCTTCTCTCCTAGGCAAGGCTGGGGTTTGCT
TCCTTTTCTTGAACCTCTCTAGTCTAGGCTTTTTTTGGGGGGGGGGCGTCCCTCTAGTTTCCAT
CCCTAAATGATGATCACCCCTGATCCGAGGATACTTTCATTTTACACACCCCTCTTACACACAG
ACCACTGTGGCCAGATGCAGACCAACCTAGGCCTGGGTAGTGACCCTAACTCTCAGGCGTTTGG
GTCTGGGGCAGCGCCCCCTCGTGTTTTGATCGTTATAGGAGATGACTCCACAGATACAAATTTA
CCACTCACTTTGTCTGTTTCTGGATGGTAAAAGGACTTGGATTTCTGACCTCTATGGGCACCAA
GGATAATAGTTTCTTTGGGTCTTGGTTTTTTACTCTTTTGGCCACTCCCTTTGTCTCCGTCTTA
ATGAGGATTCTCTGACCGTATGTGGAAGGGACTTGGGTGGTGGGGTGAGCCGTTAGCTCAGTGA
GTGGTATTGTGCATGCCTAGTGTGGGCAGCCCTGGGTTCAAGTCCTAGTACCACCCTTCTCCAA
AAGAAACAAAGAAACTAGCACATCCTTAGATATCTCTGTCCCCTTTAAAAACGTACCCTCTTAC
TTCTCACTACCTGCTGACATGCTATTTTGTTCTTAAGTCAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001388177	(Get FASTA)	NCBI Sequence Viewer
	XP_017445491	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023457.5
	ENSRNOP00000105524
	ENSRNOP00000105524.1

RefSeq Acc Id:	XP_017445491 ⟸ XM_017590002
- Peptide Label:	isoform X1
- UniProtKB:	D4A3V6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MASSQGRRRRPGTVVPGEAAETDSELSASSSEEELYLGPSGPTRGRPTGLRVAGEAAETDSEPE PEPRVAPGDLPPLVVQRDAVEAWGTEETPVLAPARSLLQLRLAESQTRLDHDVAAAVSGVYRRA GRDVAALAGRLAAAQAIGLAAAHSVRLARGDLCALAERLDIVAGCRLLPDIRGVPGIEPEQDPG PRA hide sequence

Ensembl Acc Id:

ENSRNOP00000023457 ⟸ ENSRNOT00000023457

RefSeq Acc Id:	NP_001388177 ⟸ NM_001401248
- UniProtKB:	D4A3V6 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000105524 ⟸ ENSRNOT00000163776

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A3V6-F1-model_v2	AlphaFold	D4A3V6	1-195	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1591724	AgrOrtholog
BioCyc Gene	G2FUF-60500	BioCyc
Ensembl Genes	ENSRNOG00000017463	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023457.6	UniProtKB/TrEMBL
	ENSRNOT00000163776	ENTREZGENE
	ENSRNOT00000163776.1	UniProtKB/TrEMBL
InterPro	BLOC-1_complex_su-3	UniProtKB/TrEMBL
NCBI Gene	680476	ENTREZGENE
PANTHER	BIOGENESIS OF LYSOSOME-RELATED ORGANELLES COMPLEX 1 SUBUNIT 3	UniProtKB/TrEMBL
	PTHR31974	UniProtKB/TrEMBL
Pfam	BLOC1S3	UniProtKB/TrEMBL
PhenoGen	Bloc1s3	PhenoGen
PIRSF	BLOC-1_complex_subunit_3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017463	RatGTEx
UniProt	A0ABK0L6C9_RAT	UniProtKB/TrEMBL
	D4A3V6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-05-24	Bloc1s3	biogenesis of lysosomal organelles complex-1, subunit 3	LOC686812	similar to reduced pigmentation protein	Data merged from RGD:1592537	1643240	APPROVED
2008-09-25	Bloc1s3	biogenesis of lysosomal organelles complex-1, subunit 3	Bloc1s3	biogenesis of lysosome-related organelles complex-1, subunit 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Bloc1s3	biogenesis of lysosome-related organelles complex-1, subunit 3	LOC680476	similar to reduced pigmentation protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC680476	similar to reduced pigmentation protein			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC686812	similar to reduced pigmentation protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM