Advanced Search (OLGA)

Gene: Fam131c (family with sequence similarity 131, member C) Rattus norvegicus

Analyze

Symbol:

Fam131c

Name:

family with sequence similarity 131, member C

RGD ID:

1590955

Description:

Orthologous to human FAM131C (family with sequence similarity 131 member C); INTERACTS WITH 2,3,7,8-Tetrachlorodibenzofuran; atrazine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

hypothetical protein LOC690880; LOC100911582; LOC690880; protein FAM131C-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	158,957,444 - 158,973,773 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	158,957,451 - 158,974,019 (+)	Ensembl				GRCr8
mRatBN7.2	5	153,674,459 - 153,690,791 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	153,671,772 - 153,690,800 (+)	Ensembl				mRatBN7.2
Rnor_6.0	5	159,914,931 - 159,931,089 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	159,914,931 - 159,931,090 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	163,642,663 - 163,647,669 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	160,268,665 - 160,273,424 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	152,046,363 - 152,054,951 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

atrazine (EXP,ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

choline (ISO)

cisplatin (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

dichloroacetic acid (ISO)

ethylparaben (ISO)

folic acid (ISO)

genistein (ISO)

L-methionine (ISO)

lead(0) (ISO)

N-methyl-4-phenylpyridinium (ISO)

niclosamide (ISO)

okadaic acid (ISO)

paracetamol (EXP)

resveratrol (ISO)

rotenone (ISO)

sunitinib (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Fam131c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	158,957,444 - 158,973,773 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	158,957,451 - 158,974,019 (+)	Ensembl				GRCr8
mRatBN7.2	5	153,674,459 - 153,690,791 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	153,671,772 - 153,690,800 (+)	Ensembl				mRatBN7.2
Rnor_6.0	5	159,914,931 - 159,931,089 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	159,914,931 - 159,931,090 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	163,642,663 - 163,647,669 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	160,268,665 - 160,273,424 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	152,046,363 - 152,054,951 (+)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

FAM131C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	16,057,769 - 16,073,651 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	16,057,769 - 16,073,651 (-)	Ensembl			hg38	GRCh38
GRCh37	1	16,384,264 - 16,400,146 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	16,256,851 - 16,272,714 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	1	14,864,163 - 14,877,593 (-)	NCBI		Celera
Cytogenetic Map	1	p36.13	NCBI
HuRef	1	14,902,743 - 14,918,526 (-)	NCBI		HuRef
CHM1_1	1	16,182,877 - 16,198,717 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	15,499,150 - 15,515,031 (-)	NCBI		T2T-CHM13v2.0

Fam131c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	141,095,503 - 141,111,485 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	141,095,531 - 141,111,486 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	141,368,192 - 141,384,174 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	141,368,220 - 141,384,175 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	140,924,135 - 140,940,090 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	140,640,329 - 140,656,250 (+)	NCBI		MGSCv36	mm8
Celera	4	143,185,056 - 143,201,002 (+)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	73.88	NCBI

Fam131c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955527	2,182,570 - 2,207,068 (+)	Ensembl
ChiLan1.0	NW_004955527	2,182,624 - 2,203,063 (+)	NCBI	ChiLan1.0	ChiLan1.0

FAM131C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	210,847,450 - 210,863,352 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	210,096,061 - 210,111,951 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	15,195,111 - 15,211,000 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	16,188,630 - 16,199,722 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

FAM131C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	81,595,383 - 81,611,739 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	81,595,276 - 81,611,112 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	78,114,619 - 78,147,174 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	82,224,690 - 82,257,357 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	82,240,352 - 82,257,578 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	78,977,767 - 79,010,545 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	79,994,895 - 80,027,712 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	81,062,856 - 81,095,406 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Fam131c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	37,777,546 - 37,782,672 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	3,602,881 - 3,607,452 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	3,602,330 - 3,607,462 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FAM131C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	75,193,399 - 75,212,154 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	75,193,397 - 75,213,081 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	69,529,608 - 69,545,541 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FAM131C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	116,223,237 - 116,241,144 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	116,235,177 - 116,241,379 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666054	19,719,909 - 19,767,949 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fam131c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	2,212,404 - 2,233,574 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624764	2,212,511 - 2,234,012 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Fam131c
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	16,760,483 - 16,776,180 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Fam131c
25 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	59
Count of miRNA genes:	54
Interacting mature miRNAs:	58
Transcripts:	ENSRNOT00000037202
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	141212838	172190305	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	149642129	171146538	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	133789363	172190305	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	134369199	172190305	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	136631198	172190305	Rat
1354631	Swd2	Spike wave discharge measurement QTL 2	3.64	0.0002	brain electrophysiology trait (VT:0010557)	brain total spike-and-wave discharge duration (CMO:0001740)	5	156396728	172190305	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	149805999	162987697	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	138002522	170842766	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	141764300	172190305	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	148093485	172129029	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	133789363	172190305	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	156396728	167181764	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	149661912	166600247	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298090	Bp155	Blood pressure QTL 155	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	156289283	171137955	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat

Markers in Region

D18Chm13

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	153,685,212 - 153,685,449 (+)	MAPPER	mRatBN7.2
mRatBN7.2	18	5,663,669 - 5,663,898 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	5,904,726 - 5,904,950	NCBI	Rnor6.0
Rnor_6.0	5	159,925,513 - 159,925,749	NCBI	Rnor6.0
Rnor_5.0	18	5,873,175 - 5,873,399	UniSTS	Rnor5.0
RGSC_v3.4	18	5,761,653 - 5,761,877	UniSTS	RGSC3.4
RGSC_v3.4	5	160,268,100 - 160,268,336	UniSTS	RGSC3.4
Celera	18	5,696,822 - 5,697,046	UniSTS
Celera	5	152,049,381 - 152,049,617	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	64	137	80	81	55	55	55	6	301	146	7	116	77	92	26	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001431279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764303	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017602927	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120594	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000037202 ⟹ ENSRNOP00000038610

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	158,957,451 - 158,974,019 (+)	Ensembl
mRatBN7.2 Ensembl	5	153,671,772 - 153,690,800 (+)	Ensembl
Rnor_6.0 Ensembl	5	159,914,931 - 159,931,090 (+)	Ensembl

RefSeq Acc Id:

XM_008764303 ⟹ XP_008762525

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	158,957,444 - 158,973,773 (+)	NCBI
mRatBN7.2	5	153,674,459 - 153,690,791 (+)	NCBI
Rnor_6.0	5	159,914,931 - 159,931,089 (+)	NCBI

Sequence:

show sequence

GGCTCGGCCCCGCCACCCCGTGATGGGATCCTGCGTGTCGCGAGATCTGTTCACAAGTGCCCAC
AAGAACTGCCCCAGGCCCCAGGGCACAGACCTCCTGAATCGGGACCTGCCCTCCAGCCAGCCAT
CCGCCATTGCTCCGGACCATGTTGCTGGCAAGGACAAGCAGATGGATTTCTGTTGGGATCCTTG
GCAGAGGTGCTTCCAGACCACCAATGGCTACATATCTGACTCCAGAGCTTGCCCCAGCAACTAC
AGCGTGGCTGCCCTGGCCACCTCATCCCTTGTGGGGGTGGTGCAGAGCATCAAGGACCACATCA
CAAAGCCCACGGCCATGGCCCGCGGACGAGTGGCCCACCTCATCGAGTGGAAAGGCTGGAGCGC
CCATCAGTCAGGCTGGGAGCTGTCCCCGGCAGAGGACGAACATTACTGCTGCCTCCCGGACGAG
CTGCGGGAGGCACGCTTTGCTGCGGGTGTCGCTGAGCAGTTTGCCATCACGGAGGCCACTCTGA
GTGCCTGGTCCTCTCTGGATGATGAACTGCAGCCCGAGGACAGTATCCAGGGTGCCTTCCAGCT
CCAAGACCTCGAGAGTATCTACCTTCAGGACAGCCTCCTGAGTGGCCCCTCACAGGATGACAGT
CTCCTAGCCTGCTCCCCTGGCCTCACCCTGGATGATGGCAGGCCCTCACCAGAGGAGCCCCCGA
GCCCCACCCAGCAGCACCGGCAGCGGCTGCCAGGGGCCCGTGGGCCTGAAAGCGGGGCCCACAT
GCTTGGCTCGCTGGCGTCGGTGGACAGTGGCTCGCTTTCAGAAGAGGAGGATGAAGTGTTTTAC
AACTGAGGCAACCTGGCCAGTGCGTTGTCCGCACATCCTGCTGGGAGCCCAGCTGCAGCAGTGT
ACCGTGGGGCATCTCCCGACTCCTCAGTACAAACGCAGGGTGGAGCGTGACTGGGATGGTGGCT
GGTACTCCTGTAGACCACTCAGTGCCTCCGTGGACCTGCCCACAGCCGGCTCCAGGACTCTAAG
CAGACGCCAGGGCAACCAGCCCCAGGAGAGCTGACAGTCGGGGTCCCAGGGGGACCCCATGCAA
AGATTAAGAGGATCATTTGGAGGGGGGGTCTGGGGAGCCAACCCTGACCTGGGCGCAGCCCTCC
ACATTCAGGCTGAGCATCTGCCTCATGGAAGGTGGGACCGTTTCTCCTGGACTCCTTCAGTCTC
TGGACTGTCTGTCTGTCCTTCCTCTCCTACCTGGTTCCTCTGTGACCACCACTTCCCCCATGCT
CCCCAGCCAAGAGGACCCACGTCTTCTCCCTCACACCCCCTCCCTCTCCCACGGGGTTGTCATG
TGACATTAAAGTAGTGTGTTCATCCTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001418208	(Get FASTA)	NCBI Sequence Viewer
	XP_008762525	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000038610.6

RefSeq Acc Id:

XP_008762525 ⟸ XM_008764303

- Sequence:

show sequence

MGSCVSRDLFTSAHKNCPRPQGTDLLNRDLPSSQPSAIAPDHVAGKDKQMDFCWDPWQRCFQTT
NGYISDSRACPSNYSVAALATSSLVGVVQSIKDHITKPTAMARGRVAHLIEWKGWSAHQSGWEL
SPAEDEHYCCLPDELREARFAAGVAEQFAITEATLSAWSSLDDELQPEDSIQGAFQLQDLESIY
LQDSLLSGPSQDDSLLACSPGLTLDDGRPSPEEPPSPTQQHRQRLPGARGPESGAHMLGSLASV
DSGSLSEEEDEVFYN

hide sequence

Ensembl Acc Id:

ENSRNOP00000038610 ⟸ ENSRNOT00000037202

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1M473-F1-model_v2	AlphaFold	F1M473	1-271	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1590955	AgrOrtholog
BioCyc Gene	G2FUF-39352	BioCyc
Ensembl Genes	ENSRNOG00000023008	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000037202.8	UniProtKB/TrEMBL
InterPro	FAM131	UniProtKB/TrEMBL
KEGG Report	rno:690880	UniProtKB/TrEMBL
NCBI Gene	690880	ENTREZGENE
PANTHER	PROTEIN FAM131C	UniProtKB/TrEMBL
	PTHR15736	UniProtKB/TrEMBL
Pfam	FAM131	UniProtKB/TrEMBL
PhenoGen	Fam131c	PhenoGen
RatGTEx	ENSRNOG00000023008	RatGTEx
UniProt	A6ITS9	ENTREZGENE, UniProtKB/TrEMBL
	F1M473	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-29	Fam131c	family with sequence similarity 131, member C	LOC100911582	protein FAM131C-like	Data merged from RGD:6491937	737654	PROVISIONAL
2013-05-24	Fam131c	family with sequence similarity 131, member C	LOC100364461	hypothetical protein LOC100364461	Data merged from RGD:2320999	1643240	APPROVED
2012-07-05	LOC100911582	protein FAM131C-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2010-05-05	LOC100364461	hypothetical protein LOC100364461			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-03-06	Fam131c	family with sequence similarity 131, member C	LOC690880	hypothetical protein LOC690880	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-01-09	LOC690880	hypothetical protein LOC690880	LOC686156	hypothetical protein LOC686156	Data merged from RGD:1585443	1643240	APPROVED
2006-11-20	LOC690880	hypothetical protein LOC690880			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC686156	hypothetical protein LOC686156			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message