Ift70b (intraflagellar transport 70B)

Advanced Search (OLGA)

Gene: Ift70b (intraflagellar transport 70B) Rattus norvegicus

Analyze

Symbol:

Ift70b (Ensembl: Ttc30b)

Name:

intraflagellar transport 70B (Ensembl:tetratricopeptide repeat domain 30B)

RGD ID:

1590784

Description:

Predicted to enable intraciliary transport particle B binding activity. Predicted to be involved in intraciliary transport. Predicted to be part of intraciliary transport particle B. Predicted to be active in axonemal microtubule. Orthologous to several human genes including IFT70B (intraflagellar transport 70B); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

intraflagellar transport protein 70B; LOC499814; MGC188467; similar to F54C1.5a; tetratricopeptide repeat domain 30B; tetratricopeptide repeat protein 30B; TPR repeat protein 30B; Ttc30b

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IFT70B (intraflagellar transport 70B)	HGNC	EggNOG, Ensembl, HomoloGene, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ift70b (intraflagellar transport 70B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IFT70B (intraflagellar transport 70B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IFT70B (intraflagellar transport 70B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ift70b (intraflagellar transport 70B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	IFT70A (intraflagellar transport 70A)	HGNC	Ensembl, OrthoDB, Panther, Treefam
Homo sapiens (human):	DTNBP1 (dystrobrevin binding protein 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	IFT70B (intraflagellar transport 70B)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IFT70A (intraflagellar transport 70A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ift70b (intraflagellar transport 70B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	flr (fleer)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dyf-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ttc30	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ttc30a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	81,263,074 - 81,265,645 (-)	NCBI		GRCr8
mRatBN7.2	3	60,855,809 - 60,858,380 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	60,855,575 - 60,858,389 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	64,229,040 - 64,231,611 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	72,812,699 - 72,815,270 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	70,579,937 - 70,582,508 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	62,758,754 - 62,761,325 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	62,758,758 - 62,761,325 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	69,305,673 - 69,308,244 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	58,601,840 - 58,604,421 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	60,355,424 - 60,357,978 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

split hand-foot malformation 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

aflatoxin B1 (ISO)

aflatoxin M1 (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

avobenzone (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

cisplatin (ISO)

clothianidin (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cypermethrin (ISO)

dexamethasone (ISO)

dioxygen (ISO)

ethyl methanesulfonate (ISO)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

gentamycin (EXP)

indometacin (ISO)

melphalan (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

methylparaben (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium chloride (ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

propiconazole (EXP)

quercetin (ISO)

quinolin-8-ol (ISO)

silicon dioxide (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

troglitazone (ISO)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intraciliary transport (IBA,IEA)

Cellular Component

axonemal microtubule (IBA,IEA)

intraciliary transport particle B (IBA,ISO)

Molecular Function

intraciliary transport particle B binding (IBA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:23810713

Genomics

Comparative Map Data

Ift70b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	81,263,074 - 81,265,645 (-)	NCBI		GRCr8
mRatBN7.2	3	60,855,809 - 60,858,380 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	60,855,575 - 60,858,389 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	64,229,040 - 64,231,611 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	72,812,699 - 72,815,270 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	70,579,937 - 70,582,508 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	62,758,754 - 62,761,325 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	62,758,758 - 62,761,325 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	69,305,673 - 69,308,244 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	58,601,840 - 58,604,421 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	60,355,424 - 60,357,978 (-)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

IFT70B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	177,548,998 - 177,552,796 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	177,548,998 - 177,552,796 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	178,413,726 - 178,417,524 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	178,123,126 - 178,125,770 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	172,017,725 - 172,020,369 (-)	NCBI		Celera
Cytogenetic Map	2	q31.2	NCBI
HuRef	2	170,285,947 - 170,288,591 (-)	NCBI		HuRef
CHM1_1	2	178,419,805 - 178,422,449 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	178,031,273 - 178,035,071 (-)	NCBI		T2T-CHM13v2.0

Ift70b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	75,766,193 - 75,768,806 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	75,766,193 - 75,768,929 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	75,935,849 - 75,938,462 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	75,935,849 - 75,938,585 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	75,773,906 - 75,776,519 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	75,736,688 - 75,739,424 (-)	NCBI		MGSCv36	mm8
Celera	2	77,597,551 - 77,600,164 (-)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	44.79	NCBI

IFT70B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	80,215,030 - 80,218,984 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	80,230,013 - 80,233,958 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	64,829,061 - 64,835,473 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	182,531,298 - 182,535,393 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	182,533,065 - 182,535,062 (-)	Ensembl	panpan1.1		panPan2

IFT70B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	21,270,467 - 21,273,878 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	21,290,023 - 21,293,427 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	21,415,119 - 21,418,526 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	36	21,485,241 - 21,488,653 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	21,487,275 - 21,490,678 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	21,602,379 - 21,605,784 (-)	NCBI		UU_Cfam_GSD_1.0

Ift70b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	138,325,113 - 138,327,963 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936509	6,879,007 - 6,882,406 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

Variants

Variants in Ift70b
12 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	143
Count of miRNA genes:	113
Interacting mature miRNAs:	122
Transcripts:	ENSRNOT00000013565
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
1582249	Bw77	Body weight QTL 77	3.2	0.0025	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	64655484	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
12879868	Am6	Aortic mass QTL 6		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	31426403	70668733	Rat
11565451	Bw177	Body weight QTL 177		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	3	31426403	70668733	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
11565452	Kidm57	Kidney mass QTL 57		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	31426403	70668733	Rat
12879866	Cm94	Cardiac mass QTL 94		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	31426403	70668733	Rat
12879867	Cm95	Cardiac mass QTL 95		0.047	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	31426403	70668733	Rat
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	33703347	61017857	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	62951183	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
10450804	Scl70	Serum cholesterol level QTL 70	4.7	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
10450794	Scl69	Serum cholesterol level QTL 69	6.3	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	20714090	65714090	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
2301400	Cm68	Cardiac mass QTL 68		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	31426403	70668733	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001127607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000050515 ⟹ ENSRNOP00000045862

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	60,855,575 - 60,858,389 (-)	Ensembl
Rnor_6.0 Ensembl	3	62,758,758 - 62,761,325 (-)	Ensembl

RefSeq Acc Id:

NM_001127607 ⟹ NP_001121079

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	81,263,074 - 81,265,645 (-)	NCBI
mRatBN7.2	3	60,855,809 - 60,858,380 (-)	NCBI
Rnor_6.0	3	62,758,754 - 62,761,325 (-)	NCBI
Rnor_5.0	3	69,305,673 - 69,308,244 (-)	NCBI
RGSC_v3.4	3	58,601,840 - 58,604,421 (-)	RGD
Celera	3	60,355,424 - 60,357,978 (-)	RGD

Sequence:

show sequence

TGCAAAACAACCTAGGTGAATATGGCAGGGCTGAGCAGCTCTCAGATCCCCGACGGTGAGTTCA
CAGCGGTGGTGTACAGGCTCATCCGCGACTCCCGCTACTCAGAGGCGGTGCAGCTGCTGAGCGC
AGAGCTGCAGGGGAGCCCCCGCAGCCGCGCAGGGCTGTCGCTGCTGGCCTACTGCTACTACCGC
TTGCAGGAGTTCGAGCTCGCTGCGGAGTGCTATGAGCAACTGAGCCAGATGCATCCGGAACTCG
AGCAGTACCGCCTGTACCAGGCCCAGGCGCTCTACAAGGCCTGCCTGTATCCAGAGGCCACCCG
GGTCGCCTTCCTCCTGGACAACCCCACCTATCAGACTCGAGTCCTTCGTCTGCAGGCTGCTATC
AAGTACAGTGAAGGGGATCTCCCAGGAGCCAGGAGCCTAGTGGAGCAGCTGCTGAGTGGGGAAG
GAGCTGAGGACAGTGGAGGGGAGAATGATTATGATGGTCAGATCAACCTGGGTTGTCTGCTCTA
CAAGGAGGGACACTATGAAGCTGCCTGTTCCAAGTTCTTAGCGGCCCTGCAGGCTTCTGGTTAC
CAGCCTGACATTTCCTACAACTTGGCTTTAGCCTATTACAGCAGTCGGCAGTATGCGCCTGCTC
TGAAGCATATCGCTGACATCATTGAGCGTGGCATCCGTCAACACCCAGAACTAGGTGTGGGCAT
GACCACCGAAGGCATCGATGTTCGAAGTGTTGGCAACACCATAGTTCTTCACCAGACTGCTCTG
GTGGAAGCCTTCAACCTCAAGGCAGCCATAGAGTACCAGCTGAGAAACTATGAAGCAGCTCAGG
AAGCCCTCACTGACATGCCACCCAGAGCAGAGGAAGAGTTGGACCCCGTGACCCTGCACAACCA
GGCTCTGATGAACATGGATGCCAAGCCCACGGAGGGCTTTGAAAAGCTCCAGTTTCTGCTCCAG
CAAAACCCCTTCCCCCCAGAGACCTTTGGCAACCTGCTGCTGCTTTACTGTAAATATGAGTATT
TCGACCTGGCAGCTGATGTTCTAGCAGAAAACGCCCACTTGACTTACAAGTTCCTCACACCCTA
TCTCTATGACTTCTTGGATGCCATGATCACTTGCCAGACAGCTCCTGAAGAGGCTTTCATTAAA
CTTGATGGGCTAGCAGGCATGCTGACGGAGCAGCTCAGGAGACTCACCATACAAGTACAGGATG
CAAGACATAGTAGAGATGATGAATCTGCCAAAAAGGCTGTAAACGATTATGATGAAACCCTTGA
GAAGTATATCCCTGTACTGATGGCCCAGGCCAAAATCTACTGGAATCTTGAGAATTATCCAATG
GTGGAGAAGATCTTCCGCAAATCTGTGGAATTCTGTAATGACCACGATGTGTGGAAGCTGAATG
TGGCCCATGTCCTCTTCATGCAGGAAAACAAGTACAAGGAGGCCATTGGTTTCTATGAGCCCAT
TGTCAAGAAGAATTATGATAACATCCTGAGTGTCAGCGCTATCGTATTAGCTAACCTCTGTGTT
TCCTACATTATGACAAGTCAAAATGAGGAAGCTGAGGAGCTGATGAGGAAGATTGAGAAGGAGG
AGGAACAACTCTCCTATGATGACCCGGACAAGAAAATCTACCACCTTTGCATTGTGAATTTGGT
GATAGGAACCCTTTATTGTGCCAAAGGAAACTATGACTTTGGCATCTCTCGGGTTATCAAGAGC
CTGGAGCCTTACCATAAGAAGCTGGGAACTGATACGTGGTATTATGCCAAAAGATGCTTCCTGT
CCTTACTGGAGAACATGTCAAAGCACACAATCATGCTGAGGGACAGCGTCATTCAAGAATGTGT
CCAGTTTCTAGAGCACTGTGAACTTTATGGCAGAAGCATCCCTGCTATTATCGAACAGCCCTTG
GAGGAGGAAAGAATGCACACGGGGAAGAATACGGTCACTTATGAGTCCAGAAAATTAAGGGCTC
TGATTTATGAGATCATTGGGTGGAATATGTAATTGCGGCTGGCTATGACCTTTATCATGATGAC
TTTATGTGTAAATTTTCTCTTTTCCCTGTATCTAGCTTTTGCTATTTGTACTGCTGTCTGTGAG
ACTTTGTACAGCTTGATGTAACAAAAGAACTTAGATACAACCCACACTTTTAGATCACAGCAAA
TGTGATTGTGTAAGAACCCAAGCCCTAGAAGGTACTTAGAATTTTCAAAACTGAGAAAGATACT
GTGTCTATCATGTTTCCTCCATCCTTCTGGTTTTGATGTATTTGGGCAACCTTTGTTACTCTGT
TATTCAGGGACCAGGCACTAAGTTCAGAACTTAGAAGTCCATAATGTCTTTATAATCACTCCAT
GGATTGTGTTTTCTCCTTACACAACTCCCATGATTTTATAGAGAATTTAGAGTATTAAGACAGT
TTTCCAATATAGATATAATATTTTGTCCAGATTAAATTTCTTAGGTAATAAATGGTTTTGCTAG
ATTTCAAAAGTCAGTAGACTCACTTAATAACTACAACACTAATAAATACTACAAAATAAATAAT
GAGAAGAGAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001121079	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66739	(Get FASTA)	NCBI Sequence Viewer
	B2RYD6	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000045862.2

RefSeq Acc Id:

NP_001121079 ⟸ NM_001127607

- UniProtKB:

B2RYD6 (UniProtKB/Swiss-Prot), A0A0H2UHX9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGLSSSQIPDGEFTAVVYRLIRDSRYSEAVQLLSAELQGSPRSRAGLSLLAYCYYRLQEFELA
AECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVAFLLDNPTYQTRVLRLQAAIKYSEGDL
PGARSLVEQLLSGEGAEDSGGENDYDGQINLGCLLYKEGHYEAACSKFLAALQASGYQPDISYN
LALAYYSSRQYAPALKHIADIIERGIRQHPELGVGMTTEGIDVRSVGNTIVLHQTALVEAFNLK
AAIEYQLRNYEAAQEALTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPE
TFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGM
LTEQLRRLTIQVQDARHSRDDESAKKAVNDYDETLEKYIPVLMAQAKIYWNLENYPMVEKIFRK
SVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKNYDNILSVSAIVLANLCVSYIMTSQ
NEEAEELMRKIEKEEEQLSYDDPDKKIYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYHKK
LGTDTWYYAKRCFLSLLENMSKHTIMLRDSVIQECVQFLEHCELYGRSIPAIIEQPLEEERMHT
GKNTVTYESRKLRALIYEIIGWNM

hide sequence

Ensembl Acc Id:

ENSRNOP00000045862 ⟸ ENSRNOT00000050515

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RYD6-F1-model_v2	AlphaFold	B2RYD6	1-664	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692155

Promoter ID:

EPDNEW_R2680

Type:

initiation region

Name:

Ttc30b_1

Description:

tetratricopeptide repeat domain 30B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	62,761,317 - 62,761,377	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1590784	AgrOrtholog
BioCyc Gene	G2FUF-49296	BioCyc
Ensembl Genes	ENSRNOG00000059460	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000050515.3	UniProtKB/TrEMBL
Gene3D-CATH	1.25.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7937387	IMAGE-MGC_LOAD
InterPro	TPR-like_helical_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TPR_repeat	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TT30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:499814	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:188467	IMAGE-MGC_LOAD
NCBI Gene	499814	ENTREZGENE
PANTHER	PTHR20931	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TETRATRICOPEPTIDE REPEAT PROTEIN 30B	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	TPR_16	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ift70b	PhenoGen
PROSITE	TPR_REGION	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000059460	RatGTEx
SMART	TPR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48452	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0H2UHX9	ENTREZGENE, UniProtKB/TrEMBL
	B2RYD6	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-02-27	Ift70b	intraflagellar transport 70B	Ttc30b	tetratricopeptide repeat domain 30B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-19	Ttc30b	tetratricopeptide repeat domain 30B	LOC499814	similar to F54C1.5a	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC499814	similar to F54C1.5a			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar