Advanced Search (OLGA)

Gene: Bud23 (BUD23, rRNA methyltransferase and ribosome maturation factor) Rattus norvegicus

Analyze

Symbol:

Bud23

Name:

BUD23, rRNA methyltransferase and ribosome maturation factor

RGD ID:

1589742

Description:

Predicted to enable protein heterodimerization activity and rRNA (guanine) methyltransferase activity. Predicted to be involved in positive regulation of rRNA processing and rRNA (guanine-N7)-methylation. Predicted to be located in nucleoplasm and perinuclear region of cytoplasm. Predicted to be active in nucleolus. Human ortholog(s) of this gene implicated in Williams-Beuren syndrome. Orthologous to human BUD23 (BUD23 rRNA methyltransferase and ribosome maturation factor); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC360830; LOC368084; probable 18S rRNA (guanine-N(7))-methyltransferase; similar to Putative methyltransferase WBSCR22 (Williams-Beuren syndrome chromosome region 22 protein homolog); similar to Williams-Beuren syndrome critical region protein 22; Wbscr22; Williams Beuren syndrome chromosome region 22

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,266,093 - 27,277,300 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	27,265,521 - 27,277,297 (+)	Ensembl				GRCr8
mRatBN7.2	12	21,629,551 - 21,640,758 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,629,536 - 21,640,751 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	22,769,812 - 22,781,449 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	23,382,129 - 23,393,766 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	22,450,784 - 22,461,993 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	24,669,626 - 24,680,833 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	24,669,449 - 24,680,818 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	26,669,896 - 26,681,103 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	22,724,688 - 22,735,895 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	23,392,836 - 23,404,043 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Williams-Beuren syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

corosolic acid (ISO)

cyclosporin A (ISO)

diazinon (ISO)

diethylstilbestrol (ISO)

ethanol (ISO)

gentamycin (EXP)

glyphosate (EXP)

hydrogen peroxide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methapyrilene (ISO)

methimazole (EXP)

okadaic acid (ISO)

paracetamol (ISO)

paraquat (EXP)

pirinixic acid (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sulfadimethoxine (EXP)

T-2 toxin (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloroethene (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

methylation (IEA)

positive regulation of rRNA processing (IEA,ISO)

rRNA (guanine-N7)-methylation (IBA,IEA,ISO)

rRNA processing (IEA)

Cellular Component

cytoplasm (IEA)

nucleolus (IBA,IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

perinuclear region of cytoplasm (IEA,ISO)

Molecular Function

methyltransferase activity (IEA)

protein binding (ISO)

protein heterodimerization activity (IEA,ISO)

rRNA (guanine) methyltransferase activity (IBA,IEA,ISO)

S-adenosylmethionine-dependent methyltransferase activity (IEA)

transferase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:22681889	PMID:25851604

Genomics

Comparative Map Data

Bud23
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,266,093 - 27,277,300 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	27,265,521 - 27,277,297 (+)	Ensembl				GRCr8
mRatBN7.2	12	21,629,551 - 21,640,758 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,629,536 - 21,640,751 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	22,769,812 - 22,781,449 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	23,382,129 - 23,393,766 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	22,450,784 - 22,461,993 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	24,669,626 - 24,680,833 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	24,669,449 - 24,680,818 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	26,669,896 - 26,681,103 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	22,724,688 - 22,735,895 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	23,392,836 - 23,404,043 (+)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

BUD23
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	73,683,597 - 73,698,212 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	73,683,568 - 73,698,228 (+)	Ensembl			hg38	GRCh38
GRCh37	7	73,097,927 - 73,112,542 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	72,735,834 - 72,750,478 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	7	72,542,548 - 72,557,192	NCBI
Celera	7	68,576,112 - 68,590,746 (+)	NCBI		Celera
Cytogenetic Map	7	q11.23	NCBI
HuRef	7	68,980,309 - 68,994,966 (+)	NCBI		HuRef
CHM1_1	7	73,243,634 - 73,258,288 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	7	74,884,512 - 74,899,128 (+)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	72,430,970 - 72,445,623 (+)	NCBI

Bud23
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	135,081,811 - 135,093,813 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	135,081,811 - 135,093,813 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	135,052,957 - 135,064,959 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	135,052,957 - 135,064,959 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	135,528,827 - 135,539,980 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	135,337,586 - 135,349,586 (-)	NCBI		MGSCv36	mm8
Celera	5	132,063,286 - 132,074,439 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	74.97	NCBI

Bud23
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955456	14,047,409 - 14,057,939 (-)	Ensembl
ChiLan1.0	NW_004955456	14,047,409 - 14,057,483 (-)	NCBI	ChiLan1.0	ChiLan1.0

BUD23
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	91,201,923 - 91,216,615 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	139,466,554 - 139,481,234 (-)	NCBI		NHGRI_mPanPan1
PanPan1.1	7	80,836,518 - 80,851,501 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	80,836,518 - 80,851,497 (+)	Ensembl			panPan2	panpan1.1

BUD23
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	6,583,612 - 6,596,538 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	6,583,616 - 6,595,281 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	8,281,013 - 8,293,928 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	6,398,642 - 6,411,560 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	6,398,641 - 6,410,307 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	6,388,142 - 6,401,056 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	6,335,879 - 6,348,795 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	6,499,592 - 6,512,508 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Bud23
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	131,127,809 - 131,138,719 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	2,897,432 - 2,908,802 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	2,897,884 - 2,908,758 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BUD23
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	10,960,069 - 10,973,081 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	10,960,037 - 10,973,084 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	10,656,154 - 10,669,253 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BUD23
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	9,368,950 - 9,382,951 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	9,368,726 - 9,382,925 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666070	7,119,984 - 7,134,024 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bud23
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	14,120,798 - 14,131,933 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	14,120,798 - 14,131,490 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Bud23
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	18,977,230 - 18,988,360 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Bud23
196 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	64
Count of miRNA genes:	49
Interacting mature miRNAs:	60
Transcripts:	ENSRNOT00000044449
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	1	29775522	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28133365	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	12233000	30490641	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1300174	Bw15	Body weight QTL 15	2.93		body mass (VT:0001259)	body weight loss (CMO:0001399)	12	1	28606299	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	18749469	36488809	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	18749469	34312613	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303568	Bw88	Body weight QTL 88	3		body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28606299	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	33700556	Rat

Markers in Region

RH134623

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,640,432 - 21,640,618 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	24,680,508 - 24,680,693	NCBI	Rnor6.0
Rnor_5.0	12	26,680,778 - 26,680,963	UniSTS	Rnor5.0
RGSC_v3.4	12	22,735,570 - 22,735,755	UniSTS	RGSC3.4
Celera	12	23,403,718 - 23,403,903	UniSTS
RH 3.4 Map	12	327.5	UniSTS
Cytogenetic Map	12	q12	UniSTS

RH138619

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	21,628,352 - 21,628,480 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	24,668,428 - 24,668,555	NCBI	Rnor6.0
Rnor_5.0	12	26,668,698 - 26,668,825	UniSTS	Rnor5.0
RGSC_v3.4	12	22,723,490 - 22,723,617	UniSTS	RGSC3.4
Celera	12	23,391,638 - 23,391,765	UniSTS
RH 3.4 Map	12	308.8	UniSTS
Cytogenetic Map	12	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001135743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC091752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC160891	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000044449 ⟹ ENSRNOP00000047461

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	27,265,521 - 27,277,297 (+)	Ensembl
mRatBN7.2 Ensembl	12	21,629,536 - 21,640,751 (+)	Ensembl
Rnor_6.0 Ensembl	12	24,669,449 - 24,680,818 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114014 ⟹ ENSRNOP00000090542

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	27,265,521 - 27,277,297 (+)	Ensembl
mRatBN7.2 Ensembl	12	21,629,536 - 21,640,751 (+)	Ensembl

RefSeq Acc Id:

NM_001135743 ⟹ NP_001129215

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	27,266,093 - 27,277,300 (+)	NCBI
mRatBN7.2	12	21,629,551 - 21,640,758 (+)	NCBI
Rnor_6.0	12	24,669,626 - 24,680,833 (+)	NCBI
Rnor_5.0	12	26,669,896 - 26,681,103 (+)	NCBI
RGSC_v3.4	12	22,724,688 - 22,735,895 (+)	RGD
Celera	12	23,392,836 - 23,404,043 (+)	RGD

Sequence:

show sequence

AGCGTGTTGCCATCCCTTAGAGATGGCATCTCGTAGCCGGAGACCAGAACACAGCGGACCGCCA
GAGCTGTTTTATGACCAGAATGAAGCCCGGAAATACGTTCGCAACTCACGGATGATTGACATCC
AGACCAAGATGACTGAGCGAGCACTGGAGCTCCTCTGTTTGCCAGAGGGCCAGCCTTCTTATCT
GTTAGACATCGGCTGTGGTTCTGGACTGAGTGGAGACTATATCTCAGAAGAGGGGCACTACTGG
GTGGGCATTGACATCAGCCCTGCCATGTTGGACGCCGCCTTGGACCGCGACACAGAGGGAGACC
TACTACTAGGGGACATGGGCCAGGGAGTCCCTTTCAGACCGGGTTCTTTTGATGGCTGCATCAG
CATCTCTGCGGTGCAGTGGCTCTGCAACGCAAACAAGAAGTCGGACATCCCTGCCAGGCGCCTC
TACTGCTTCTTTTCTTCTCTGTACTCTGCCCTCGTCCGTGGGGCCCGAGCTGTCCTGCAGCTGT
ACCCCGAGAACTCGGAGCAGCTGGAGCTGATCACAACCCAGGCCACGAGAGCAGGCTTCACTGG
CGGTGTGGTGGTGGACTTCCCCAACAGTGCCAAAGCAAAGAAGTTCTACCTCTGTCTGTTTTCT
GGGCCTTCCACCTCCCTGCCAAAGGGGCTGACTGAAAGTCAGGAAGCAGACCAGGCCTCCGAGT
CCGCTTTCACCAGTGAACGGGCTCCACACAAGAAGGCCCGGAGAGACCTGGTGAAGAAGAGCCG
GGAGTGGGTCCTAGAGAAGAAGGAGAGGCGCAGGCGCCAGGGCAAGGAGGTCAGACCTGACACG
CAGTACACCGGCCGCAAGCGCAAGCCCCGCTTCTGAGGGAGCCACATCTGATCAGCCGGAGAGC
CTGGCCACCCACACACATCCAGTCTGCAGATGCAGACGGTCCTGCCACCCACTCTGCTCAGAGT
GGGCGCTATCCAACCCAGGACCTGCCTCAGGAATTTTCTGGATTGAACTGTTTACCTCAGCAGC
TAGCAACATAGTATTTTAGAAGAGTTGGGACGCTCTCAAAATATTTCTTCACTAAGAGTTGCAG
GGATCTGGGTTTGGCAGCTCACATCCTATAATCGCAACACCCTCCCGGGAGTCTGAGACAAGAA
GTTGGAAAGTTCCAGGCCTGTCTGGGCTACACAGCAAAAACCTGTCTTAAAAACCAAAAGGAAA
AACATTTCTAAGAATGTTTTATTTTGTCCTAAATGCATTAAATTACTTTCTAAGTAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001129215	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI60891	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000047461
	ENSRNOP00000047461.3
	ENSRNOP00000090542.2

RefSeq Acc Id:

NP_001129215 ⟸ NM_001135743

- UniProtKB:

B1H275 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASRSRRPEHSGPPELFYDQNEARKYVRNSRMIDIQTKMTERALELLCLPEGQPSYLLDIGCGS
GLSGDYISEEGHYWVGIDISPAMLDAALDRDTEGDLLLGDMGQGVPFRPGSFDGCISISAVQWL
CNANKKSDIPARRLYCFFSSLYSALVRGARAVLQLYPENSEQLELITTQATRAGFTGGVVVDFP
NSAKAKKFYLCLFSGPSTSLPKGLTESQEADQASESAFTSERAPHKKARRDLVKKSREWVLEKK
ERRRRQGKEVRPDTQYTGRKRKPRF

hide sequence

Ensembl Acc Id:

ENSRNOP00000047461 ⟸ ENSRNOT00000044449

Ensembl Acc Id:

ENSRNOP00000090542 ⟸ ENSRNOT00000114014

Protein Domains

18S rRNA (guanine(1575)-N(7))-methyltransferase Methyltransferase type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1H275-F1-model_v2	AlphaFold	B1H275	1-281	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698561

Promoter ID:

EPDNEW_R9086

Type:

multiple initiation site

Name:

Bud23_1

Description:

BUD23, rRNA methyltransferase and ribosome maturation factor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	24,669,620 - 24,669,680	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1589742	AgrOrtholog
BioCyc Gene	G2FUF-19604	BioCyc
Ensembl Genes	ENSRNOG00000033700	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000044449	ENTREZGENE
	ENSRNOT00000044449.7	UniProtKB/TrEMBL
	ENSRNOT00000114014.2	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.150	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7442902	IMAGE-MGC_LOAD
InterPro	Bud23-like	UniProtKB/TrEMBL
	Methyltransf_11	UniProtKB/TrEMBL
	SAM-dependent_MTases-like	UniProtKB/TrEMBL
	Unchr_MeTrfase_Williams-Beuren	UniProtKB/TrEMBL
KEGG Report	rno:368084	UniProtKB/TrEMBL
MGC_CLONE	MGC:188319	IMAGE-MGC_LOAD
NCBI Gene	368084	ENTREZGENE
PANTHER	18S RRNA (GUANINE-N(7))-METHYLTRANSFERASE-RELATED	UniProtKB/TrEMBL
	PTHR12734	UniProtKB/TrEMBL
Pfam	Methyltransf_11	UniProtKB/TrEMBL
	WBS_methylT	UniProtKB/TrEMBL
PhenoGen	Bud23	PhenoGen
RatGTEx	ENSRNOG00000033700	RatGTEx
Superfamily-SCOP	SSF53335	UniProtKB/TrEMBL
UniProt	A0A8I6GIY8_RAT	UniProtKB/TrEMBL
	B1H275	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-07	Bud23	BUD23, rRNA methyltransferase and ribosome maturation factor	Wbscr22	Williams Beuren syndrome chromosome region 22	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-05-24	Wbscr22	Williams Beuren syndrome chromosome region 22	LOC360830		Data merged from RGD:1597085	1643240	APPROVED
2008-10-13	LOC360830		LOC368084	similar to Putative methyltransferase WBSCR22 (Williams-Beuren syndrome chromosome region 22 protein homolog)	Symbol and Name updated	1299863	PROVISIONAL
2008-03-05	Wbscr22	Williams Beuren syndrome chromosome region 22	LOC360830	similar to Williams-Beuren syndrome critical region protein 22	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC368084	similar to Putative methyltransferase WBSCR22 (Williams-Beuren syndrome chromosome region 22 protein homolog)			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC360830	similar to Williams-Beuren syndrome critical region protein 22			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message