Advanced Search (OLGA)

Gene: C8h19orf38 (similar to human chromosome 19 open reading frame 38) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

C8h19orf38

Name:

similar to human chromosome 19 open reading frame 38

RGD ID:

1587445

Description:

Predicted to be located in membrane. Orthologous to human C19orf38 (chromosome 19 open reading frame 38); INTERACTS WITH bisphenol A; 1,2-dichloroethane (ortholog); 17beta-estradiol (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC691141; LOC691141; uncharacterized protein LOC691141

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	28,337,629 - 28,371,806 (+)	NCBI		GRCr8
mRatBN7.2	8	20,061,494 - 20,095,705 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	20,078,639 - 20,095,696 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	24,110,769 - 24,127,643 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	22,408,608 - 22,423,195 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	20,308,271 - 20,325,328 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	22,557,769 - 22,576,163 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	22,559,098 - 22,576,154 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	22,611,882 - 22,630,272 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	20,629,814 - 20,648,525 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	21,469,788 - 21,486,866 (+)	NCBI		Celera
Cytogenetic Map	8	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C8h19orf38	Rat	alpha-mannosidosis		ISO	C19orf38 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Deficiency of alpha-mannosidase	ClinVar	PMID:28492532
C8h19orf38	Rat	Charcot-Marie-Tooth disease dominant intermediate B		ISO	C19orf38 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth disease dominant intermediate B	ClinVar	PMID:28492532
C8h19orf38	Rat	episodic ataxia type 2		ISO	C19orf38 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Episodic ataxia type 2	ClinVar	PMID:28492532
C8h19orf38	Rat	familial hypercholesterolemia		ISO	C19orf38 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial hypercholesterolemia	ClinVar	PMID:16250003 more ...
C8h19orf38	Rat	glutaric acidemia I		ISO	C19orf38 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Glutaric aciduria and type 1	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C8h19orf38	Rat	1,2-dichloroethane	decreases expression	ISO	AB124611 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of AB124611 mRNA	CTD	PMID:28960355
C8h19orf38	Rat	17beta-estradiol	decreases expression	ISO	AB124611 (Mus musculus)	6480464	Estradiol results in decreased expression of AB124611 mRNA	CTD	PMID:39298647
C8h19orf38	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	AB124611 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of AB124611 mRNA	CTD	PMID:21570461 and PMID:28922406
C8h19orf38	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	AB124611 (Mus musculus)	6480464	bisphenol S results in decreased expression of AB124611 mRNA	CTD	PMID:39298647
C8h19orf38	Rat	all-trans-retinoic acid	increases expression	ISO	C19orf38 (Homo sapiens)	6480464	Tretinoin results in increased expression of C19ORF38 mRNA	CTD	PMID:33167477
C8h19orf38	Rat	aristolochic acid A	increases expression	ISO	C19orf38 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of C19ORF38 mRNA	CTD	PMID:33212167
C8h19orf38	Rat	benzo[a]pyrene	decreases expression	ISO	C19orf38 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of C19ORF38 mRNA	CTD	PMID:22316170
C8h19orf38	Rat	benzo[a]pyrene	affects methylation	ISO	C19orf38 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of C19ORF38 promoter	CTD	PMID:27901495
C8h19orf38	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of C19ORF38 mRNA	CTD	PMID:25181051
C8h19orf38	Rat	bisphenol A	affects splicing	ISO	AB124611 (Mus musculus)	6480464	bisphenol A affects the splicing of AB124611 mRNA	CTD	PMID:37894381
C8h19orf38	Rat	chloroprene	decreases expression	ISO	AB124611 (Mus musculus)	6480464	Chloroprene results in decreased expression of AB124611 mRNA	CTD	PMID:23125180
C8h19orf38	Rat	chlorpyrifos	decreases expression	ISO	AB124611 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of AB124611 mRNA	CTD	PMID:32715474
C8h19orf38	Rat	cisplatin	increases expression	ISO	C19orf38 (Homo sapiens)	6480464	Cisplatin results in increased expression of C19ORF38 mRNA	CTD	PMID:27594783
C8h19orf38	Rat	cisplatin	multiple interactions	ISO	C19orf38 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of C19ORF38 mRNA	CTD	PMID:27392435
C8h19orf38	Rat	cisplatin	decreases expression	ISO	C19orf38 (Homo sapiens)	6480464	Cisplatin results in decreased expression of C19ORF38 mRNA	CTD	PMID:27392435
C8h19orf38	Rat	dimethylarsinic acid	multiple interactions	ISO	AB124611 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of AB124611 mRNA	CTD	PMID:34876320
C8h19orf38	Rat	methylarsonic acid	multiple interactions	ISO	AB124611 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of AB124611 mRNA	CTD	PMID:34876320
C8h19orf38	Rat	serpentine asbestos	decreases expression	ISO	C19orf38 (Homo sapiens)	6480464	Asbestos and Serpentine results in decreased expression of C19ORF38 mRNA	CTD	PMID:21148743
C8h19orf38	Rat	sodium arsenate	multiple interactions	ISO	AB124611 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of AB124611 mRNA	CTD	PMID:34876320
C8h19orf38	Rat	sodium arsenite	increases expression	ISO	C19orf38 (Homo sapiens)	6480464	sodium arsenite results in increased expression of C19ORF38 mRNA	CTD	PMID:38568856
C8h19orf38	Rat	sodium arsenite	increases expression	ISO	AB124611 (Mus musculus)	6480464	sodium arsenite results in increased expression of AB124611 mRNA	CTD	PMID:36209798
C8h19orf38	Rat	sodium arsenite	multiple interactions	ISO	AB124611 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of AB124611 mRNA	CTD	PMID:34876320
C8h19orf38	Rat	testosterone	increases expression	ISO	C19orf38 (Homo sapiens)	6480464	Testosterone results in increased expression of C19ORF38 mRNA	CTD	PMID:33359661
C8h19orf38	Rat	tetrachloromethane	increases expression	ISO	AB124611 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of AB124611 mRNA	CTD	PMID:31919559
C8h19orf38	Rat	titanium dioxide	decreases expression	ISO	AB124611 (Mus musculus)	6480464	titanium dioxide results in decreased expression of AB124611 mRNA	CTD	PMID:35295148
C8h19orf38	Rat	triphenyl phosphate	affects expression	ISO	C19orf38 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of C19ORF38 mRNA	CTD	PMID:37042841

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C8h19orf38	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C8h19orf38	Rat	protein binding	enables	ISO	C19orf38 (Homo sapiens)	1624291	UniProtKB:Q07627 and PMID:32296183	RGD	PMID:32296183

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

C8h19orf38
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	28,337,629 - 28,371,806 (+)	NCBI		GRCr8
mRatBN7.2	8	20,061,494 - 20,095,705 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	20,078,639 - 20,095,696 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	24,110,769 - 24,127,643 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	22,408,608 - 22,423,195 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	20,308,271 - 20,325,328 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	22,557,769 - 22,576,163 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	22,559,098 - 22,576,154 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	22,611,882 - 22,630,272 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	20,629,814 - 20,648,525 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	21,469,788 - 21,486,866 (+)	NCBI		Celera
Cytogenetic Map	8	q13	NCBI

C19orf38
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	10,836,685 - 10,869,790 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	10,836,575 - 10,869,790 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	10,959,091 - 10,980,466 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	10,820,089 - 10,841,473 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	19	10,853,950 - 10,875,203 (+)	NCBI		Celera
Cytogenetic Map	19	p13.2	NCBI
HuRef	19	10,537,179 - 10,558,424 (+)	NCBI		HuRef
CHM1_1	19	10,960,345 - 10,981,617 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	10,963,557 - 10,996,802 (+)	NCBI		T2T-CHM13v2.0

AB124611
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	21,437,410 - 21,456,629 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	21,437,472 - 21,456,629 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	21,526,114 - 21,545,333 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	21,526,176 - 21,545,333 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	21,330,721 - 21,349,237 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	21,276,679 - 21,295,195 (+)	NCBI		MGSCv36	mm8
Celera	9	18,794,853 - 18,813,749 (+)	NCBI		Celera
Cytogenetic Map	9	A3	NCBI
cM Map	9	7.82	NCBI

LOC102014685
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	1,945,560 - 1,956,990 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	1,945,560 - 1,956,990 (+)	NCBI	ChiLan1.0	ChiLan1.0

C20H19orf38
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	15,756,741 - 15,789,717 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	14,755,329 - 14,788,322 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	10,390,158 - 10,423,117 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	11,112,020 - 11,143,060 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	11,123,539 - 11,142,641 (+)	Ensembl	panpan1.1		panPan2

C20H19orf38
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	50,374,159 - 50,395,695 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	50,373,622 - 50,386,594 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	50,247,233 - 50,259,550 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	50,896,216 - 50,908,532 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	50,895,676 - 50,909,308 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	50,105,295 - 50,117,390 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	50,532,806 - 50,544,873 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	50,774,238 - 50,786,379 (-)	NCBI		UU_Cfam_GSD_1.0

CUNH19orf38
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	209,282,566 - 209,304,942 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	1,054,045 - 1,072,139 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936659	1,059,059 - 1,072,148 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C2H19orf38
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	69,585,883 - 69,600,756 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	69,584,550 - 69,600,760 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	70,020,195 - 70,035,676 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CUNH19orf38
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	9,855,101 - 9,865,266 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666074	10,080,496 - 10,119,327 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

CUNH19orf38
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	2,815,991 - 2,832,469 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	2,807,144 - 2,831,583 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in C8h19orf38
195 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	65
Count of miRNA genes:	59
Interacting mature miRNAs:	61
Transcripts:	ENSRNOT00000041091
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	2097640	47097640	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	2097640	47097640	Rat
9590084	Insglur5	Insulin/glucose ratio QTL 5	18.54	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	8	1	24597739	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	2097640	47097640	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
2317882	Alcrsp24	Alcohol response QTL 24	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	8	1	25902202	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	2097640	47097640	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat

RH135268

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	20,095,479 - 20,095,664 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	22,575,938 - 22,576,122	NCBI	Rnor6.0
Rnor_5.0	8	22,630,047 - 22,630,231	UniSTS	Rnor5.0
RGSC_v3.4	8	20,648,309 - 20,648,493	UniSTS	RGSC3.4
Celera	8	21,486,650 - 21,486,834	UniSTS
RH 3.4 Map	8	205.8	UniSTS
Cytogenetic Map	8	q13	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001109624	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006242674	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008765985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082182	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266178	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC130555	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000041091 ⟹ ENSRNOP00000041436

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	20,078,639 - 20,095,696 (+)	Ensembl
Rnor_6.0 Ensembl	8	22,559,098 - 22,576,154 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099602 ⟹ ENSRNOP00000081290

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	20,078,664 - 20,095,694 (+)	Ensembl

RefSeq Acc Id:

NM_001109624 ⟹ NP_001103094

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	28,354,748 - 28,371,804 (+)	NCBI
mRatBN7.2	8	20,078,639 - 20,095,696 (+)	NCBI
Rnor_6.0	8	22,559,098 - 22,576,154 (+)	NCBI
Rnor_5.0	8	22,611,882 - 22,630,272 (+)	NCBI
RGSC_v3.4	8	20,629,814 - 20,648,525 (+)	RGD
Celera	8	21,469,788 - 21,486,866 (+)	RGD

Sequence:

show sequence

CAACACTCACTTCTCCTTTCTCCACTGTGGTCTCGGGCTGGCAGGGAGCCCCAGATCCCCGTGGCCTCGGCCAGCTTTCCCAGACGTACATGGGAGGAGAGATGCTTTCCCAGACGTACATGGGAGGA
GAGATGCCCTGGACCATTCTGCTGTTTGCATCTGGCTCCTTGGCCATCCCTGCACCGTCTATCTTCCTGGTGCCCCCCTTCCCAAGCAGCCGTGAGGATCCCATCTACCTCTCATGCACAGCCCCCAA
GGACATCCTCGGGGCCAACTTCACCCTGTTCCGAGGGGGAGAGGCGGTCCAGCTCCTACAAGCCCCCTCAGATCAGCACAGTGTCACATTCAATGTGACTGGTAGTGGCAGTGGTGGCAGCAATGAGG
CTGCAGGGGGCAACTTCCGCTGTCAGTATGGTGTGCTGGGAGAGCACAGTGAGCCCCAGCTGTCCGACTTCAGCCAGGAGGTGCAGGTCTCCTTCCCAGTCCCCACCTGGATCCTGGCGCTCTCCCTG
AGCCTGGCTGGCGCTGTCCTCCTCTCAGGGCTGGTGGTCATCGCAGTGCTGGTGAGGAAAGCTAAGGCCAAAAACTTACAGATGCAGAGAGAGCGTGAATCCTGCTGGGCTCAGATCAACTTCACCAA
CACAGACATGTCCTTTGATAACTCTCTGTTTGCCATCTCCACGAAAATGACTCAAGAAGACTCAATGGTAACCCTGGACTCAGGGCCTCGGAAGAGGCCTACCTCTGCATCGTTCTCTCCAGAGCCCC
CTGAGTTCAGCACTTTCCGGGCCTGCCAATGAGGCTGAAGAATGAGGACCCCTTTATCCAGTTCTTTCCTTCCCACAGCCCCAGGCTGCAGAAGCTGGCCATCTGTCTGGAGACTCGGCAGTAGGGAG
GAGTCAAGCCACAGCTTTCTTATGGAACAACTGGCCAAAGGAAGGAGACACCTGGTGTTGTGACCTTCCTCATAGAAGACAATTAGTTGGGGTATCAGCCTAGGGGCAAGACAGAAAGCCAGAAGCCT
CTGTAAAGAAGGGTCACTCTTGAATCAGGACACCCAGCCAGGCCTAAGAGGTTACATTCTGTACGGACTTTCCTGTGGTTCCCCAACTGCAATTGACTTCCAGACTGGGTGTTTTATTTGGGGGAGAG
ATGTGTATATTTTTGTTGCTGTTGTTTTCAGATAAGGTCTCACTGTGTAGTCCTGCCTGAACTGGAAGTTACTGTGTAGACCAGGCTGGCCCACAATAGAGATCCACCTGCCTCTGCCTCCAGAGTGT
TGGGATTAAAGTACCTGCCAC

hide sequence

RefSeq Acc Id:

XM_039082179 ⟹ XP_038938107

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	28,344,710 - 28,371,806 (+)	NCBI
mRatBN7.2	8	20,068,598 - 20,095,705 (+)	NCBI

RefSeq Acc Id:

XM_039082180 ⟹ XP_038938108

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	28,337,629 - 28,371,806 (+)	NCBI
mRatBN7.2	8	20,061,494 - 20,095,705 (+)	NCBI

RefSeq Acc Id:

XM_039082182 ⟹ XP_038938110

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	28,337,629 - 28,371,349 (+)	NCBI
mRatBN7.2	8	20,061,494 - 20,095,705 (+)	NCBI

RefSeq Acc Id:

XM_039082183 ⟹ XP_038938111

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	28,344,710 - 28,371,806 (+)	NCBI
mRatBN7.2	8	20,068,598 - 20,095,705 (+)	NCBI

RefSeq Acc Id:

XM_063266176 ⟹ XP_063122246

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	28,337,629 - 28,371,806 (+)	NCBI

RefSeq Acc Id:

XM_063266177 ⟹ XP_063122247

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	28,354,792 - 28,371,806 (+)	NCBI

RefSeq Acc Id:

XM_063266178 ⟹ XP_063122248

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	28,337,629 - 28,371,806 (+)	NCBI

RefSeq Acc Id:

XM_063266179 ⟹ XP_063122249

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	28,354,792 - 28,371,806 (+)	NCBI


Protein RefSeqs	NP_001103094	(Get FASTA)	NCBI Sequence Viewer
	XP_038938107	(Get FASTA)	NCBI Sequence Viewer
	XP_038938108	(Get FASTA)	NCBI Sequence Viewer
	XP_038938110	(Get FASTA)	NCBI Sequence Viewer
	XP_038938111	(Get FASTA)	NCBI Sequence Viewer
	XP_063122246	(Get FASTA)	NCBI Sequence Viewer
	XP_063122247	(Get FASTA)	NCBI Sequence Viewer
	XP_063122248	(Get FASTA)	NCBI Sequence Viewer
	XP_063122249	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL78287	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000041436
	ENSRNOP00000041436.2
	ENSRNOP00000081290
	ENSRNOP00000081290.1

RefSeq Acc Id:

NP_001103094 ⟸ NM_001109624

- UniProtKB:

D3ZMI7 (UniProtKB/TrEMBL), A6JNS9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGGEMLSQTYMGGEMPWTILLFASGSLAIPAPSIFLVPPFPSSREDPIYLSCTAPKDILGANFTLFRGGEAVQLLQAPSDQHSVTFNVTGSGSGGSNEAAGGNFRCQYGVLGEHSEPQLSDFSQEVQV
SFPVPTWILALSLSLAGAVLLSGLVVIAVLVRKAKAKNLQMQRERESCWAQINFTNTDMSFDNSLFAISTKMTQEDSMVTLDSGPRKRPTSASFSPEPPEFSTFRACQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000041436 ⟸ ENSRNOT00000041091

RefSeq Acc Id:	XP_038938110 ⟸ XM_039082182
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038938108 ⟸ XM_039082180
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I5ZRB8 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038938107 ⟸ XM_039082179
- Peptide Label:	isoform X1
- UniProtKB:	D3ZMI7 (UniProtKB/TrEMBL), A6JNS9 (UniProtKB/TrEMBL)

Protein Domains

C19orf38 Ig

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZMI7-F1-model_v2	AlphaFold	D3ZMI7	1-236	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13695782

Promoter ID:

EPDNEW_R6307

Type:

single initiation site

Name:

LOC691141_1

Description:

hypothetical protein LOC691141

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	22,559,121 - 22,559,181	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-31417	BioCyc
Ensembl Genes	ENSRNOG00000033256	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000041091	ENTREZGENE
	ENSRNOT00000041091.3	UniProtKB/TrEMBL
	ENSRNOT00000099602	ENTREZGENE
	ENSRNOT00000099602.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/TrEMBL
InterPro	C19orf38_Ig	UniProtKB/TrEMBL
	HIDE1	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
KEGG Report	rno:691141	UniProtKB/TrEMBL
NCBI Gene	691141	ENTREZGENE
PANTHER	PROTEIN HIDE1	UniProtKB/TrEMBL
	PTHR36859	UniProtKB/TrEMBL
Pfam	Ig_C19orf38	UniProtKB/TrEMBL
PhenoGen	C8h19orf38	PhenoGen
RatGTEx	ENSRNOG00000033256	RatGTEx
UniProt	A0A8I5ZRB8	ENTREZGENE, UniProtKB/TrEMBL
	A6JNS9	ENTREZGENE, UniProtKB/TrEMBL
	D3ZMI7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-09-19	C8h19orf38	similar to human chromosome 19 open reading frame 38	LOC691141	hypothetical protein LOC691141	Symbol and Name Changed	1299863	APPROVED
2008-01-09	LOC691141	hypothetical protein LOC691141	LOC687186	hypothetical protein LOC687186	Data merged from RGD:1588900	1643240	APPROVED
2006-11-19	LOC691141	hypothetical protein LOC691141			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	LOC687186	hypothetical protein LOC687186			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar