Symbol:
Elovl1
Name:
ELOVL fatty acid elongase 1
RGD ID:
1587151
Description:
Predicted to enable fatty acid elongase activity. Predicted to be involved in ceramide biosynthetic process; establishment of skin barrier; and fatty acid biosynthetic process. Predicted to be located in endoplasmic reticulum. Predicted to be active in endoplasmic reticulum membrane. Orthologous to human ELOVL1 (ELOVL fatty acid elongase 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 1; elongation of very long chain fatty acids protein 1; hypothetical protein LOC679532; LOC679532; similar to Elongation of very long chain fatty acids protein 1; very long chain fatty acid elongase 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ELOVL1 (ELOVL fatty acid elongase 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Elovl1 (ELOVL fatty acid elongase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Elovl1 (ELOVL fatty acid elongase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ELOVL1 (ELOVL fatty acid elongase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ELOVL1 (ELOVL fatty acid elongase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Elovl1 (ELOVL fatty acid elongase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ELOVL1 (ELOVL fatty acid elongase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ELOVL1 (ELOVL fatty acid elongase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Elovl1 (ELOVL fatty acid elongase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ELOVL1 (ELOVL fatty acid elongase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Elovl1 (ELOVL fatty acid elongase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
elovl1b (ELOVL fatty acid elongase 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
elovl1a (ELOVL fatty acid elongase 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG16904
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
ELO2
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoInspector)
Drosophila melanogaster (fruit fly):
CG17821
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG18609
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG2781
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG30008
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG31141
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG31522
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG31523
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG33110
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG5326
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG6660
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG8534
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG9458
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG9459
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
bond
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
eloF
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
sit
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
elovl1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 137,246,781 - 137,251,351 (+) NCBI GRCr8 mRatBN7.2 5 131,961,478 - 131,965,961 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 131,961,322 - 131,965,958 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 134,670,003 - 134,673,190 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 136,424,640 - 136,427,827 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 136,447,038 - 136,450,225 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 137,255,868 - 137,260,486 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 137,255,908 - 137,260,483 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 141,046,751 - 141,049,947 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 138,909,438 - 138,912,186 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 130,508,244 - 130,511,440 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Elovl1 Rat (-)-alpha-phellandrene decreases expression ISO ELOVL1 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of ELOVL1 mRNA CTD PMID:25075043 Elovl1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ELOVL1 mRNA CTD PMID:22079256 Elovl1 Rat (1->4)-beta-D-glucan multiple interactions ISO Elovl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ELOVL1 mRNA CTD PMID:36331819 Elovl1 Rat 1,2-dimethylhydrazine multiple interactions ISO Elovl1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ELOVL1 mRNA CTD PMID:22206623 Elovl1 Rat 17beta-estradiol affects expression ISO ELOVL1 (Homo sapiens) 6480464 Estradiol affects the expression of ELOVL1 mRNA CTD PMID:22574217 Elovl1 Rat 17beta-estradiol increases expression ISO Elovl1 (Mus musculus) 6480464 Estradiol results in increased expression of ELOVL1 mRNA CTD PMID:39298647 Elovl1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Elovl1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to ELOVL1 promoter] CTD PMID:19654925 Elovl1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ELOVL1 mRNA CTD PMID:34747641 Elovl1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Elovl1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ELOVL1 mRNA CTD PMID:21570461 Elovl1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ELOVL1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ELOVL1 mRNA CTD PMID:20106945 and PMID:21632981 Elovl1 Rat 2-bromohexadecanoic acid multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of ELOVL1 protein] CTD PMID:38195004 Elovl1 Rat 2-hydroxypropanoic acid decreases expression ISO ELOVL1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ELOVL1 mRNA CTD PMID:30851411 Elovl1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Elovl1 (Mus musculus) 6480464 Fenretinide results in decreased expression of ELOVL1 mRNA CTD PMID:28973697 Elovl1 Rat 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime increases expression ISO ELOVL1 (Homo sapiens) 6480464 6-(4-chlorophenyl)imidazo(2 more ... CTD PMID:30611723 Elovl1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ELOVL1 mRNA CTD PMID:24780913 Elovl1 Rat acrolein multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of ELOVL1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of ELOVL1 mRNA CTD PMID:32699268 Elovl1 Rat acrylamide increases expression ISO ELOVL1 (Homo sapiens) 6480464 Acrylamide results in increased expression of ELOVL1 mRNA CTD PMID:32763439 Elovl1 Rat alpha-phellandrene decreases expression ISO ELOVL1 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of ELOVL1 mRNA CTD PMID:25075043 Elovl1 Rat alpha-pinene multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of ELOVL1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of ELOVL1 mRNA CTD PMID:32699268 Elovl1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of ELOVL1 mRNA CTD PMID:38685447 Elovl1 Rat arsane multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of ELOVL1 mRNA CTD PMID:32525701 Elovl1 Rat arsenic atom multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of ELOVL1 mRNA CTD PMID:32525701 Elovl1 Rat benzalkonium chloride increases expression ISO ELOVL1 (Homo sapiens) 6480464 Benzalkonium Compounds results in increased expression of ELOVL1 mRNA CTD PMID:29155129 Elovl1 Rat benzo[a]pyrene increases expression ISO Elovl1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ELOVL1 mRNA CTD PMID:19770486 Elovl1 Rat benzo[a]pyrene decreases expression ISO Elovl1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ELOVL1 mRNA CTD PMID:21569818 Elovl1 Rat benzo[a]pyrene multiple interactions ISO Elovl1 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to ELOVL1 promoter] CTD PMID:19654925 Elovl1 Rat benzo[b]fluoranthene increases expression ISO Elovl1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of ELOVL1 mRNA CTD PMID:26377693 Elovl1 Rat Benzo[k]fluoranthene decreases expression ISO Elovl1 (Mus musculus) 6480464 benzo(k)fluoranthene results in decreased expression of ELOVL1 mRNA CTD PMID:26377693 Elovl1 Rat beta-lapachone increases expression ISO ELOVL1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ELOVL1 mRNA CTD PMID:38218311 Elovl1 Rat bis(2-ethylhexyl) phthalate increases expression ISO ELOVL1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of ELOVL1 mRNA CTD PMID:31163220 Elovl1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Elovl1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ELOVL1 mRNA CTD PMID:33754040 Elovl1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Elovl1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ELOVL1 mRNA CTD PMID:35550907 Elovl1 Rat bisphenol A multiple interactions EXP 6480464 indole-3-carbinol promotes the reaction [bisphenol A results in increased expression of ELOVL1 mRNA] CTD PMID:27178563 Elovl1 Rat bisphenol A increases expression ISO Elovl1 (Mus musculus) 6480464 bisphenol A results in increased expression of ELOVL1 mRNA CTD PMID:34585602 Elovl1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ELOVL1 gene CTD PMID:28505145 Elovl1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ELOVL1 mRNA CTD PMID:27571134 Elovl1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ELOVL1 mRNA CTD PMID:25181051 and PMID:27178563 Elovl1 Rat bisphenol AF increases expression ISO ELOVL1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ELOVL1 protein CTD PMID:34186270 Elovl1 Rat Bisphenol B increases expression ISO ELOVL1 (Homo sapiens) 6480464 bisphenol B results in increased expression of ELOVL1 protein CTD PMID:34186270 Elovl1 Rat cadmium atom multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of ELOVL1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of ELOVL1 protein CTD PMID:38195004 Elovl1 Rat cadmium dichloride multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of ELOVL1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of ELOVL1 protein CTD PMID:38195004 Elovl1 Rat carbon nanotube decreases expression ISO Elovl1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Elovl1 Rat carbon nanotube increases expression ISO Elovl1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Elovl1 Rat CGP 52608 multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ELOVL1 gene] CTD PMID:28238834 Elovl1 Rat chlormequat chloride increases expression EXP 6480464 Chlormequat results in increased expression of ELOVL1 protein CTD PMID:34958886 Elovl1 Rat chloroprene decreases expression ISO Elovl1 (Mus musculus) 6480464 Chloroprene results in decreased expression of ELOVL1 mRNA CTD PMID:23125180 Elovl1 Rat chlorpyrifos increases expression ISO Elovl1 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ELOVL1 mRNA CTD PMID:37019170 Elovl1 Rat copper(II) chloride increases expression ISO ELOVL1 (Homo sapiens) 6480464 cupric chloride results in increased expression of ELOVL1 mRNA CTD PMID:17211630 Elovl1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of ELOVL1 mRNA CTD PMID:26577399 and PMID:27523638 Elovl1 Rat cyclosporin A increases expression ISO ELOVL1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ELOVL1 mRNA CTD PMID:25562108 Elovl1 Rat cyproconazole increases expression ISO Elovl1 (Mus musculus) 6480464 cyproconazole results in increased expression of ELOVL1 mRNA CTD PMID:22334560 Elovl1 Rat diazinon increases methylation ISO ELOVL1 (Homo sapiens) 6480464 Diazinon results in increased methylation of ELOVL1 gene CTD PMID:22964155 Elovl1 Rat Dibutyl phosphate affects expression ISO ELOVL1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ELOVL1 mRNA CTD PMID:37042841 Elovl1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of ELOVL1 mRNA CTD PMID:21266533 Elovl1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of ELOVL1 mRNA CTD PMID:21551480 Elovl1 Rat dorsomorphin multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Elovl1 Rat epoxiconazole increases expression ISO Elovl1 (Mus musculus) 6480464 epoxiconazole results in increased expression of ELOVL1 mRNA CTD PMID:22334560 Elovl1 Rat ethanol increases expression ISO Elovl1 (Mus musculus) 6480464 Ethanol results in increased expression of ELOVL1 mRNA CTD PMID:19167417 Elovl1 Rat fenamidone increases expression ISO Elovl1 (Mus musculus) 6480464 fenamidone results in increased expression of ELOVL1 mRNA CTD PMID:27029645 Elovl1 Rat fluoranthene multiple interactions ISO Elovl1 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of ELOVL1 mRNA CTD PMID:28329830 Elovl1 Rat folic acid multiple interactions ISO Elovl1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ELOVL1 mRNA CTD PMID:22206623 Elovl1 Rat fonofos increases methylation ISO ELOVL1 (Homo sapiens) 6480464 Fonofos results in increased methylation of ELOVL1 promoter CTD PMID:22847954 Elovl1 Rat furan increases methylation EXP 6480464 furan results in increased methylation of ELOVL1 gene CTD PMID:22079235 Elovl1 Rat genistein increases expression ISO ELOVL1 (Homo sapiens) 6480464 Genistein results in increased expression of ELOVL1 protein CTD PMID:20884965 Elovl1 Rat genistein multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 ESR2 promotes the reaction [Genistein results in increased expression of ELOVL1 protein] CTD PMID:20884965 Elovl1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ELOVL1 mRNA CTD PMID:33387578 Elovl1 Rat GW 4064 increases expression ISO ELOVL1 (Homo sapiens) 6480464 GW 4064 results in increased expression of ELOVL1 mRNA CTD PMID:30611723 Elovl1 Rat GW 7647 increases expression ISO ELOVL1 (Homo sapiens) 6480464 GW 7647 results in increased expression of ELOVL1 mRNA CTD PMID:30611723 Elovl1 Rat hydrogen cyanide decreases expression ISO Elovl1 (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of ELOVL1 mRNA CTD PMID:33914522 Elovl1 Rat indole-3-methanol multiple interactions EXP 6480464 indole-3-carbinol promotes the reaction [bisphenol A results in increased expression of ELOVL1 mRNA] CTD PMID:27178563 Elovl1 Rat isoprenaline increases expression ISO Elovl1 (Mus musculus) 6480464 Isoproterenol results in increased expression of ELOVL1 mRNA CTD PMID:20003209 Elovl1 Rat isotretinoin decreases expression ISO ELOVL1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of ELOVL1 mRNA CTD PMID:20436886 Elovl1 Rat ivermectin decreases expression ISO ELOVL1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ELOVL1 protein CTD PMID:32959892 Elovl1 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of ELOVL1 mRNA CTD PMID:22641619 Elovl1 Rat obeticholic acid increases expression ISO ELOVL1 (Homo sapiens) 6480464 obeticholic acid results in increased expression of ELOVL1 mRNA CTD PMID:27939613 Elovl1 Rat ozone multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of ELOVL1 mRNA more ... CTD PMID:32699268 Elovl1 Rat ozone multiple interactions ISO Elovl1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of ELOVL1 mRNA CTD PMID:34911549 Elovl1 Rat paracetamol increases expression ISO ELOVL1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ELOVL1 mRNA CTD PMID:22230336 Elovl1 Rat parathion increases methylation ISO ELOVL1 (Homo sapiens) 6480464 Parathion results in increased methylation of ELOVL1 promoter CTD PMID:22847954 Elovl1 Rat parathion decreases expression ISO Elovl1 (Mus musculus) 6480464 Parathion results in decreased expression of ELOVL1 mRNA CTD PMID:34813904 Elovl1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Elovl1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ELOVL1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of ELOVL1 mRNA CTD PMID:36331819 Elovl1 Rat perfluorooctanoic acid increases expression ISO Elovl1 (Mus musculus) 6480464 perfluorooctanoic acid results in increased expression of ELOVL1 mRNA CTD PMID:17681415 Elovl1 Rat phenobarbital increases expression ISO Elovl1 (Mus musculus) 6480464 Phenobarbital results in increased expression of ELOVL1 mRNA CTD PMID:23091169 Elovl1 Rat phenylmercury acetate increases expression ISO ELOVL1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of ELOVL1 mRNA CTD PMID:26272509 Elovl1 Rat phenylmercury acetate multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ELOVL1 mRNA CTD PMID:27188386 Elovl1 Rat pirinixic acid increases activity EXP 6480464 pirinixic acid results in increased activity of ELOVL1 protein CTD PMID:15654130 Elovl1 Rat potassium chromate decreases expression ISO ELOVL1 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ELOVL1 mRNA CTD PMID:22079256 Elovl1 Rat potassium chromate multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ELOVL1 mRNA CTD PMID:22079256 Elovl1 Rat potassium cyanide increases expression ISO Elovl1 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of ELOVL1 mRNA CTD PMID:33914522 Elovl1 Rat progesterone decreases expression ISO ELOVL1 (Homo sapiens) 6480464 Progesterone results in decreased expression of ELOVL1 mRNA CTD PMID:18037150 Elovl1 Rat propiconazole increases expression ISO Elovl1 (Mus musculus) 6480464 propiconazole results in increased expression of ELOVL1 mRNA CTD PMID:21278054 and PMID:22334560 Elovl1 Rat quercetin increases expression ISO ELOVL1 (Homo sapiens) 6480464 Quercetin results in increased expression of ELOVL1 mRNA CTD PMID:21632981 Elovl1 Rat rac-lactic acid decreases expression ISO ELOVL1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ELOVL1 mRNA CTD PMID:30851411 Elovl1 Rat resveratrol increases expression ISO Elovl1 (Mus musculus) 6480464 resveratrol results in increased expression of ELOVL1 protein CTD PMID:25505154 Elovl1 Rat SB 431542 multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Elovl1 Rat senecionine decreases expression ISO Elovl1 (Mus musculus) 6480464 senecionine results in decreased expression of ELOVL1 protein CTD PMID:35357534 Elovl1 Rat sodium arsenate multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of ELOVL1 mRNA CTD PMID:32525701 Elovl1 Rat sodium arsenite decreases expression ISO ELOVL1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ELOVL1 mRNA CTD PMID:38568856 Elovl1 Rat sodium arsenite multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 sodium arsenite promotes the reaction [ELOVL1 protein binds to CAPRIN1 protein] CTD PMID:33939924 Elovl1 Rat sodium dodecyl sulfate increases expression ISO ELOVL1 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in increased expression of ELOVL1 mRNA CTD PMID:29155129 Elovl1 Rat tamoxifen decreases expression ISO Elovl1 (Mus musculus) 6480464 Tamoxifen results in decreased expression of ELOVL1 mRNA CTD PMID:25123088 Elovl1 Rat terbufos increases methylation ISO ELOVL1 (Homo sapiens) 6480464 terbufos results in increased methylation of ELOVL1 promoter CTD PMID:22847954 Elovl1 Rat tetraphene increases expression ISO Elovl1 (Mus musculus) 6480464 benz(a)anthracene results in increased expression of ELOVL1 mRNA CTD PMID:26377693 Elovl1 Rat Theaflavin 3,3'-digallate multiple interactions ISO Elovl1 (Mus musculus) 6480464 theaflavin-3 and 3'-digallate inhibits the reaction [LEP gene mutant form affects the expression of ELOVL1 mRNA] CTD PMID:36105184 Elovl1 Rat thiram decreases expression ISO ELOVL1 (Homo sapiens) 6480464 Thiram results in decreased expression of ELOVL1 mRNA CTD PMID:38568856 Elovl1 Rat trichostatin A increases expression ISO ELOVL1 (Homo sapiens) 6480464 trichostatin A results in increased expression of ELOVL1 mRNA CTD PMID:24935251 Elovl1 Rat triphenyl phosphate affects expression ISO ELOVL1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ELOVL1 mRNA CTD PMID:37042841 Elovl1 Rat valproic acid increases methylation ISO ELOVL1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ELOVL1 gene CTD PMID:29154799 Elovl1 Rat valproic acid increases expression ISO ELOVL1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ELOVL1 mRNA CTD PMID:23179753 more ... Elovl1 Rat valproic acid multiple interactions ISO ELOVL1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ELOVL1 mRNA CTD PMID:27188386 Elovl1 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of ELOVL1 mRNA CTD PMID:29427782
Biological Process
Only show annotations with direct experimental evidence (0 objects hidden)
Elovl1 Rat ceramide biosynthetic process involved_in ISO Elovl1 (Mus musculus) 1624291 PMID:23689133 RGD PMID:23689133 Elovl1 Rat establishment of skin barrier involved_in ISO Elovl1 (Mus musculus) 1624291 PMID:23689133 RGD PMID:23689133 Elovl1 Rat fatty acid biosynthetic process involved_in IEA UniProtKB-KW:KW-0275 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Elovl1 Rat fatty acid biosynthetic process involved_in IEA UniPathway:UPA00094 1600115 GO_REF:0000041 UniProt GO_REF:0000041 Elovl1 Rat fatty acid elongation, monounsaturated fatty acid involved_in ISO ELOVL1 (Homo sapiens) 1624291 PMID:20166112 RGD PMID:20166112 Elovl1 Rat fatty acid elongation, monounsaturated fatty acid involved_in IEA UniRule:UR000254934 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Elovl1 Rat fatty acid elongation, monounsaturated fatty acid involved_in IEA UniProtKB:Q9BW60 and ensembl:ENSP000003615361600115 GO_REF:0000107 Ensembl GO_REF:0000107 Elovl1 Rat fatty acid elongation, monounsaturated fatty acid involved_in IBA MGI:1195976 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Elovl1 Rat fatty acid elongation, polyunsaturated fatty acid involved_in IBA MGI:1858960 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Elovl1 Rat fatty acid elongation, saturated fatty acid involved_in ISO ELOVL1 (Homo sapiens) 1624291 PMID:20166112 and PMID:20937905 RGD PMID:20166112 and PMID:20937905 Elovl1 Rat fatty acid elongation, saturated fatty acid involved_in IEA UniProtKB:Q9BW60 and ensembl:ENSP000003615361600115 GO_REF:0000107 Ensembl GO_REF:0000107 Elovl1 Rat fatty acid elongation, saturated fatty acid involved_in IEA UniRule:UR000254934 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Elovl1 Rat fatty acid elongation, saturated fatty acid involved_in IEA InterPro:IPR033681 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Elovl1 Rat fatty acid elongation, saturated fatty acid involved_in IBA FB:FBgn0260960 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Elovl1 Rat fatty acid metabolic process involved_in IEA UniProtKB-KW:KW-0276 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Elovl1 Rat lipid biosynthetic process involved_in IEA ARBA:ARBA00027236 1600115 GO_REF:0000117 UniProt GO_REF:0000117 Elovl1 Rat lipid metabolic process involved_in IEA UniProtKB-KW:KW-0443 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Elovl1 Rat long-chain fatty-acyl-CoA biosynthetic process involved_in IEA UniRule:UR000254934 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Elovl1 Rat sphingolipid biosynthetic process involved_in ISO ELOVL1 (Homo sapiens) 1624291 PMID:20937905 RGD PMID:20937905 Elovl1 Rat sphingolipid biosynthetic process involved_in ISO Elovl1 (Mus musculus) 1624291 PMID:20253178 RGD PMID:20253178 Elovl1 Rat sphingolipid biosynthetic process involved_in IBA CGD:CAL0000190970 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Elovl1 Rat sphingolipid biosynthetic process involved_in IEA UniProtKB:Q9BW60 and ensembl:ENSP000003615361600115 GO_REF:0000107 Ensembl GO_REF:0000107 Elovl1 Rat unsaturated fatty acid biosynthetic process involved_in IEA UniRule:UR000254934 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Elovl1 Rat very long-chain fatty acid biosynthetic process involved_in ISO ELOVL1 (Homo sapiens) 1624291 PMID:20166112 and PMID:20937905 RGD PMID:20166112 and PMID:20937905 Elovl1 Rat very long-chain fatty acid biosynthetic process involved_in IBA FB:FBgn0034382 more ... 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Elovl1 Rat very long-chain fatty acid biosynthetic process involved_in IEA UniProtKB:Q9BW60 and ensembl:ENSP000003615361600115 GO_REF:0000107 Ensembl GO_REF:0000107 Elovl1 Rat very long-chain fatty acid biosynthetic process involved_in IEA UniRule:UR000254934 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Elovl1 Rat very long-chain fatty acid biosynthetic process involved_in IEA InterPro:IPR033681 1600115 GO_REF:0000002 InterPro GO_REF:0000002
(-)-alpha-phellandrene (ISO) (-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-bromohexadecanoic acid (ISO) 2-hydroxypropanoic acid (ISO) 4-hydroxyphenyl retinamide (ISO) 6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) acrylamide (ISO) alpha-phellandrene (ISO) alpha-pinene (ISO) amitrole (EXP) arsane (ISO) arsenic atom (ISO) benzalkonium chloride (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) Benzo[k]fluoranthene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlormequat chloride (EXP) chloroprene (ISO) chlorpyrifos (ISO) copper(II) chloride (ISO) Cuprizon (EXP) cyclosporin A (ISO) cyproconazole (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) diuron (EXP) dorsomorphin (ISO) epoxiconazole (ISO) ethanol (ISO) fenamidone (ISO) fluoranthene (ISO) folic acid (ISO) fonofos (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) GW 4064 (ISO) GW 7647 (ISO) hydrogen cyanide (ISO) indole-3-methanol (EXP) isoprenaline (ISO) isotretinoin (ISO) ivermectin (ISO) lead diacetate (EXP) obeticholic acid (ISO) ozone (ISO) paracetamol (ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP) potassium chromate (ISO) potassium cyanide (ISO) progesterone (ISO) propiconazole (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) SB 431542 (ISO) senecionine (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) tamoxifen (ISO) terbufos (ISO) tetraphene (ISO) Theaflavin 3,3'-digallate (ISO) thiram (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) valproic acid (EXP,ISO)
Biological Process
ceramide biosynthetic process (ISO) establishment of skin barrier (ISO) fatty acid biosynthetic process (IEA) fatty acid elongation, monounsaturated fatty acid (IBA,IEA,ISO) fatty acid elongation, polyunsaturated fatty acid (IBA) fatty acid elongation, saturated fatty acid (IBA,IEA,ISO) fatty acid metabolic process (IEA) lipid biosynthetic process (IEA) lipid metabolic process (IEA) long-chain fatty-acyl-CoA biosynthetic process (IEA) sphingolipid biosynthetic process (IBA,IEA,ISO) unsaturated fatty acid biosynthetic process (IEA) very long-chain fatty acid biosynthetic process (IBA,IEA,ISO)
Elovl1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 137,246,781 - 137,251,351 (+) NCBI GRCr8 mRatBN7.2 5 131,961,478 - 131,965,961 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 131,961,322 - 131,965,958 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 134,670,003 - 134,673,190 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 136,424,640 - 136,427,827 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 136,447,038 - 136,450,225 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 137,255,868 - 137,260,486 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 137,255,908 - 137,260,483 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 141,046,751 - 141,049,947 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 138,909,438 - 138,912,186 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 130,508,244 - 130,511,440 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
ELOVL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 43,363,401 - 43,368,011 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 43,363,398 - 43,368,074 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 43,829,072 - 43,833,682 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 43,601,659 - 43,606,286 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 43,498,165 - 43,502,792 NCBI Celera 1 42,111,226 - 42,115,853 (-) NCBI Celera Cytogenetic Map 1 p34.2 NCBI HuRef 1 41,948,810 - 41,953,487 (-) NCBI HuRef CHM1_1 1 43,945,527 - 43,950,204 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 43,233,949 - 43,238,559 (-) NCBI T2T-CHM13v2.0
Elovl1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 118,285,321 - 118,290,150 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 118,285,290 - 118,290,150 (+) Ensembl GRCm39 Ensembl GRCm38 4 118,426,874 - 118,432,953 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 118,428,093 - 118,432,953 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 118,100,698 - 118,105,521 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 117,926,025 - 117,930,848 (+) NCBI MGSCv36 mm8 Celera 4 117,153,631 - 117,158,454 (+) NCBI Celera Cytogenetic Map 4 D2.1 NCBI cM Map 4 54.61 NCBI
Elovl1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955537 2,945,509 - 2,950,146 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955537 2,945,509 - 2,950,146 (-) NCBI ChiLan1.0 ChiLan1.0
ELOVL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 183,424,960 - 183,446,629 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 182,566,350 - 182,588,012 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 42,664,818 - 42,686,475 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 44,044,693 - 44,064,111 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 44,044,693 - 44,048,769 (-) Ensembl panpan1.1 panPan2
ELOVL1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 16,798,305 - 16,803,071 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 16,798,370 - 16,802,899 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 16,925,313 - 16,930,087 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 16,965,026 - 16,969,802 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 16,965,100 - 16,969,969 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 16,757,503 - 16,762,275 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 16,826,506 - 16,831,275 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 16,900,074 - 16,904,850 (+) NCBI UU_Cfam_GSD_1.0
Elovl1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 58,940,387 - 58,945,152 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 24,764,718 - 24,769,947 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 24,765,173 - 24,769,903 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ELOVL1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 167,881,352 - 167,886,124 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 167,881,357 - 167,886,125 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 155,333,073 - 155,340,903 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ELOVL1
Elovl1
.
Predicted Target Of
Count of predictions: 69 Count of miRNA genes: 65 Interacting mature miRNAs: 67 Transcripts: ENSRNOT00000037160 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 7365049 Bp359 Blood pressure QTL 359 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128071929 134724733 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1581505 Rf54 Renal function QTL 54 kidney physiology trait (VT:0002136) kidney 20-HETE level (CMO:0001854) 5 128033842 133011550 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 7394710 Emca12 Estrogen-induced mammary cancer QTL 12 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 124160767 133749643 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
D5Wox40
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 137,251,262 - 137,251,433 (+) Marker Load Pipeline mRatBN7.2 5 131,965,869 - 131,966,040 (+) MAPPER mRatBN7.2 Rnor_6.0 5 137,260,395 - 137,260,565 NCBI Rnor6.0 Rnor_5.0 5 141,049,859 - 141,050,029 UniSTS Rnor5.0 Celera 5 130,511,352 - 130,511,522 UniSTS Cytogenetic Map 5 q36 UniSTS
BB151133
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 131,965,773 - 131,965,865 (+) MAPPER mRatBN7.2 Rnor_6.0 5 137,260,299 - 137,260,390 NCBI Rnor6.0 Rnor_5.0 5 141,049,763 - 141,049,854 UniSTS Rnor5.0 Celera 5 130,511,256 - 130,511,347 UniSTS Cytogenetic Map 5 q36 UniSTS
AA963388
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 131,965,784 - 131,965,938 (+) MAPPER mRatBN7.2 Rnor_6.0 5 137,260,310 - 137,260,463 NCBI Rnor6.0 Rnor_5.0 5 141,049,774 - 141,049,927 UniSTS Rnor5.0 Celera 5 130,511,267 - 130,511,420 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000037160 ⟹ ENSRNOP00000033374
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 131,961,446 - 131,965,956 (+) Ensembl Rnor_6.0 Ensembl 5 137,257,287 - 137,260,483 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000088022 ⟹ ENSRNOP00000074677
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 131,961,322 - 131,965,937 (+) Ensembl Rnor_6.0 Ensembl 5 137,255,924 - 137,259,796 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092755 ⟹ ENSRNOP00000075935
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 131,963,915 - 131,965,958 (+) Ensembl Rnor_6.0 Ensembl 5 137,255,925 - 137,259,949 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092766
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 137,255,908 - 137,258,982 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092836
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 137,258,844 - 137,259,804 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092972
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 137,258,424 - 137,259,626 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093001 ⟹ ENSRNOP00000075969
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 131,963,037 - 131,965,956 (+) Ensembl Rnor_6.0 Ensembl 5 137,257,637 - 137,259,546 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093017
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 137,255,922 - 137,259,177 (+) Ensembl
RefSeq Acc Id:
NM_001044275 ⟹ NP_001037740
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 137,248,155 - 137,251,351 (+) NCBI mRatBN7.2 5 131,962,762 - 131,965,958 (+) NCBI Rnor_6.0 5 137,257,287 - 137,260,483 (+) NCBI Rnor_5.0 5 141,046,751 - 141,049,947 (+) NCBI RGSC_v3.4 5 138,909,438 - 138,912,186 (+) RGD Celera 5 130,508,244 - 130,511,440 (+) RGD
Sequence:
CAAACTGAGAATTCATGGCTGGTTTGGGAGAGAATGCTGGGTGTGGATTTTTGGCAATTCTTCTGGCTTTGGCCAGAGGTTCTGGCCAGAAGTTTCTGGAGAACCTACAAACGTAGCTTATCTGGCTG
hide sequence
RefSeq Acc Id:
XM_017593616 ⟹ XP_017449105
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 137,246,781 - 137,251,351 (+) NCBI mRatBN7.2 5 131,961,478 - 131,965,961 (+) NCBI Rnor_6.0 5 137,255,868 - 137,260,486 (+) NCBI
Sequence:
CGGCCCGCCCTCTCCCCCTCTGGTGACAGAAAGTCGGCCCAGCAGATGAGGAAGTGGCCGACAGGAGGCCCTGGGGACTTCTCTCCGGCCCTGATCCCTTTGAACCCTTCACTGCTGCCCGCCTGGCT
hide sequence
RefSeq Acc Id:
XM_017593617 ⟹ XP_017449106
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 137,246,968 - 137,251,351 (+) NCBI mRatBN7.2 5 131,961,573 - 131,965,959 (+) NCBI Rnor_6.0 5 137,256,253 - 137,260,486 (+) NCBI
Sequence:
CACCTTGGCCCTCTGACCCCCATTTGCTCACACCTAGTTCTTTTCCAGTATCTCCTGGCCTTCCTCCCTTTGCTCCCTCCTCTCGTTCCCTTTCCTGCTCCTTGCCGGTGCCCTTTTTCCTTCCCATC
hide sequence
RefSeq Acc Id:
XM_017593618 ⟹ XP_017449107
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 137,246,968 - 137,251,351 (+) NCBI mRatBN7.2 5 131,961,573 - 131,965,959 (+) NCBI Rnor_6.0 5 137,256,253 - 137,260,486 (+) NCBI
Sequence:
CACCTTGGCCCTCTGACCCCCATTTGCTCACACCTAGTTCTTTTCCAGTATCTCCTGGCCTTCCTCCCTTTGCTCCCTCCTCTCGTTCCCTTTCCTGCTCCTTGCCGGTGCCCTTTTTCCTTCCCATC
hide sequence
RefSeq Acc Id:
NP_001037740 ⟸ NM_001044275
- UniProtKB:
Q5U2Z8 (UniProtKB/TrEMBL), A0A0G2K8N7 (UniProtKB/TrEMBL)
- Sequence:
MEAVVNLYQELMKCADPRIQNYPLMGSPLLITSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVTLSLYIVYEFLMSGWLSTYTWRCDPVDFSNNPEALRMVRVAWLFMLSKVIELMDTVIF
hide sequence
RefSeq Acc Id:
XP_017449105 ⟸ XM_017593616
- Peptide Label:
isoform X1
- UniProtKB:
Q5U2Z8 (UniProtKB/TrEMBL), A0A0G2K8N7 (UniProtKB/TrEMBL)
- Sequence:
MEAVVNLYQELMKCADPRIQNYPLMGSPLLITSILLTYVYFVLSLGPRIMANRKPFQLRGFMIV
hide sequence
RefSeq Acc Id:
XP_017449107 ⟸ XM_017593618
- Peptide Label:
isoform X1
- UniProtKB:
Q5U2Z8 (UniProtKB/TrEMBL), A0A0G2K8N7 (UniProtKB/TrEMBL)
- Sequence:
MEAVVNLYQELMKCADPRIQNYPLMGSPLLITSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVTLSLYIVYEFLMSGWLSTYTWRCDPVDFSNNPEALRMVRVAWLFMLSKVIELMDTVIF
hide sequence
RefSeq Acc Id:
XP_017449106 ⟸ XM_017593617
- Peptide Label:
isoform X1
- UniProtKB:
Q5U2Z8 (UniProtKB/TrEMBL), A0A0G2K8N7 (UniProtKB/TrEMBL)
- Sequence:
MEAVVNLYQELMKCADPRIQNYPLMGSPLLITSILLTYVYFVLSLGPRIMANRKPFQLRGFMIV
hide sequence
Ensembl Acc Id:
ENSRNOP00000075935 ⟸ ENSRNOT00000092755
Ensembl Acc Id:
ENSRNOP00000075969 ⟸ ENSRNOT00000093001
Ensembl Acc Id:
ENSRNOP00000074677 ⟸ ENSRNOT00000088022
Ensembl Acc Id:
ENSRNOP00000033374 ⟸ ENSRNOT00000037160
RGD ID: 13693965 Promoter ID: EPDNEW_R4488 Type: initiation region Name: Elovl1_1 Description: ELOVL fatty acid elongase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R4489 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 137,255,911 - 137,255,971 EPDNEW
RGD ID: 13693969 Promoter ID: EPDNEW_R4489 Type: initiation region Name: Elovl1_2 Description: ELOVL fatty acid elongase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R4488 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 137,257,590 - 137,257,650 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-08-02
Elovl1
ELOVL fatty acid elongase 1
Elovl1
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-04-21
Elovl1
elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 1
LOC679532
similar to Elongation of very long chain fatty acids protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-01-09
LOC679532
similar to Elongation of very long chain fatty acids protein 1
LOC684910
similar to Elongation of very long chain fatty acids protein 1
Data merged from RGD:1584445
1643240 APPROVED
2006-11-19
LOC679532
similar to Elongation of very long chain fatty acids protein 1
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-11-19
LOC684910
similar to Elongation of very long chain fatty acids protein 1
Symbol and Name status set to provisional
70820 PROVISIONAL
