Tatdn2 (TatD DNase domain containing 2)

Gene: Tatdn2 (TatD DNase domain containing 2) Rattus norvegicus

Analyze

Symbol:

Tatdn2

Name:

TatD DNase domain containing 2

RGD ID:

1586017

Description:

Predicted to enable hydrolase activity, acting on ester bonds. Orthologous to human TATDN2 (TatD DNase domain containing 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; cobalt dichloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC500295; putative deoxyribonuclease TATDN2; similar to TatD DNase domain containing 2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TATDN2 (TatD DNase domain containing 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Tatdn2 (TatD DNase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tatdn2 (TatD DNase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TATDN2 (TatD DNase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TATDN2 (TatD DNase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tatdn2 (TatD DNase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TATDN2 (TatD DNase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TATDN2 (TatD DNase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tatdn2 (TatD DNase domain containing 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CACNA1A (calcium voltage-gated channel subunit alpha1 A)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	TATDN2 (TatD DNase domain containing 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tatdn2 (TatD DNase domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tatdn2 (TatD DNase domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y24F12A.1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y37H2A.1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	148,400,454 - 148,416,501 (+)	NCBI		GRCr8
mRatBN7.2	4	146,845,156 - 146,865,708 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	146,845,156 - 146,860,897 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	152,229,798 - 152,245,549 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	148,010,669 - 148,026,420 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	146,638,923 - 146,654,663 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	145,653,299 - 145,669,343 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	145,653,602 - 145,669,343 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	208,949,721 - 208,966,479 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	149,602,011 - 149,617,752 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	135,399,486 - 135,415,227 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Atrioventricular Septal Defect 2 (ISO)

genetic disease (ISO)

Myoclonic Epilepsies (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

aflatoxin B1 (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

caffeine (ISO)

carbon nanotube (ISO)

cobalt dichloride (EXP)

copper(II) sulfate (ISO)

coumestrol (ISO)

dexamethasone (ISO)

diethyl maleate (ISO)

epoxiconazole (ISO)

ethanol (ISO)

ferric oxide (ISO)

fluoranthene (ISO)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

indometacin (ISO)

methapyrilene (EXP)

nefazodone (EXP)

nimesulide (EXP)

paracetamol (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

pirinixic acid (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

thioacetamide (EXP)

trichloroethene (ISO)

Triptolide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Molecular Function

hydrolase activity, acting on ester bonds (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Tatdn2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	148,400,454 - 148,416,501 (+)	NCBI		GRCr8
mRatBN7.2	4	146,845,156 - 146,865,708 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	146,845,156 - 146,860,897 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	152,229,798 - 152,245,549 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	148,010,669 - 148,026,420 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	146,638,923 - 146,654,663 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	145,653,299 - 145,669,343 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	145,653,602 - 145,669,343 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	208,949,721 - 208,966,479 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	149,602,011 - 149,617,752 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	4	135,399,486 - 135,415,227 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

TATDN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	10,248,459 - 10,281,218 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	10,248,023 - 10,281,218 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	10,290,143 - 10,322,902 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	10,265,596 - 10,297,902 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	10,225,985 - 10,258,714 (+)	NCBI		Celera
Cytogenetic Map	3	p25.3	NCBI
HuRef	3	10,225,912 - 10,258,237 (+)	NCBI		HuRef
CHM1_1	3	10,240,337 - 10,273,054 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	10,241,757 - 10,274,517 (+)	NCBI		T2T-CHM13v2.0

Tatdn2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	113,674,090 - 113,688,030 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	113,674,011 - 113,688,030 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	113,697,050 - 113,711,082 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	113,697,050 - 113,711,069 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	113,647,493 - 113,661,062 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	113,663,276 - 113,676,845 (+)	NCBI		MGSCv36	mm8
Celera	6	115,522,974 - 115,536,584 (+)	NCBI		Celera
Cytogenetic Map	6	E3	NCBI
cM Map	6	52.83	NCBI

Tatdn2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955561	1,653,471 - 1,671,407 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955561	1,653,471 - 1,673,260 (+)	NCBI	ChiLan1.0	ChiLan1.0

TATDN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	10,243,822 - 10,276,744 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	10,248,626 - 10,281,504 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	10,184,220 - 10,217,099 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	10,536,852 - 10,568,824 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	10,536,852 - 10,568,824 (+)	Ensembl	panpan1.1		panPan2

TATDN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	8,101,994 - 8,131,578 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	8,136,353 - 8,165,798 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	8,131,699 - 8,161,303 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	8,131,819 - 8,161,268 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	7,853,575 - 7,882,935 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	8,199,302 - 8,228,667 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	8,172,945 - 8,202,298 (-)	NCBI		UU_Cfam_GSD_1.0

Tatdn2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	15,837,496 - 15,861,917 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936602	3,048,006 - 3,072,684 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936602	3,047,798 - 3,072,216 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TATDN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	66,422,345 - 66,441,980 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	66,421,472 - 66,441,978 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	73,484,191 - 73,504,649 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TATDN2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	46,284,624 - 46,321,473 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	46,284,685 - 46,321,710 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	120,215,765 - 120,256,480 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tatdn2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	5,262,848 - 5,289,717 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	5,263,741 - 5,289,601 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tatdn2
56 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	203
Count of miRNA genes:	155
Interacting mature miRNAs:	174
Transcripts:	ENSRNOT00000038964
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	105789505	150789505	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	106649412	151649412	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	106805662	151805662	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	109827074	154827074	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	109827074	154827074	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	110870972	155870972	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	116179486	151161268	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
12798527	Anxrr58	Anxiety related response QTL 58	4.11	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	119463257	147278687	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	120260281	147278687	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	120926564	148090731	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	132642577	167139601	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	146565735	175236377	Rat

Markers in Region

RH143482

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	146,860,270 - 146,860,421 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	145,668,716 - 145,668,866	NCBI	Rnor6.0
Rnor_5.0	4	208,965,115 - 208,965,265	UniSTS	Rnor5.0
RGSC_v3.4	4	149,617,125 - 149,617,275	UniSTS	RGSC3.4
Celera	4	135,414,600 - 135,414,750	UniSTS
RH 3.4 Map	4	948.6	UniSTS
Cytogenetic Map	4	q42	UniSTS

AU048121

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	146,844,318 - 146,844,478 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	145,652,765 - 145,652,924	NCBI	Rnor6.0
Rnor_5.0	4	208,949,164 - 208,949,323	UniSTS	Rnor5.0
RGSC_v3.4	4	149,601,174 - 149,601,333	UniSTS	RGSC3.4
Cytogenetic Map	4	q42	UniSTS

RH139061

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	146,860,115 - 146,860,315 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	145,668,561 - 145,668,760	NCBI	Rnor6.0
Rnor_5.0	4	208,964,960 - 208,965,159	UniSTS	Rnor5.0
RGSC_v3.4	4	149,616,970 - 149,617,169	UniSTS	RGSC3.4
Celera	4	135,414,445 - 135,414,644	UniSTS
Cytogenetic Map	4	q42	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	55	39	19	39	8	11	74	35	41	11	8
Low			2	2		2
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109252	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010065694	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_592239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC096599	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC127397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000038964 ⟹ ENSRNOP00000030898

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	146,845,179 - 146,860,868 (+)	Ensembl
Rnor_6.0 Ensembl	4	145,653,602 - 145,669,343 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000118522 ⟹ ENSRNOP00000097765

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	146,845,156 - 146,860,897 (+)	Ensembl

RefSeq Acc Id:

NM_001109252 ⟹ NP_001102722

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,400,760 - 148,416,501 (+)	NCBI
mRatBN7.2	4	146,845,156 - 146,860,898 (+)	NCBI
Rnor_6.0	4	145,653,602 - 145,669,343 (+)	NCBI
Rnor_5.0	4	208,949,721 - 208,966,479 (+)	NCBI
RGSC_v3.4	4	149,602,011 - 149,617,752 (+)	RGD
Celera	4	135,399,486 - 135,415,227 (+)	RGD

Sequence:

show sequence

CGCTGCTCCGGAAGCGCCTCGGCGTCTCGGGAGTGGCGCGGTGTTGACAGCTGCGCTTGCCGAC
TTCGGCTGCGCGTCGTTCGGGTTCGGCGCTCGGCCCGTGGGCGCTTCTCGGAGCGGTGTGGCGT
CCCTGAAGCCCGCAGCACTGGGATGGGCAGACGACAGGAACGGGAAAGGTGCCCATGGCGTCGG
AACGGCGCAAGGTCAAGTATCACTGGGGCAGCACGTCGGAAGGGTGTCCCAGCAAGCGCAGCCG
CCCCCGGGAGCCCCGCAATGTGGCCCCCTCCAGCCGGCCAGGTCGCAGGTTTGCGTCGCGTCCT
CGAGGGGCCAGCAGCCCCCAGCGTCTGAAAGTCCGGCGCGGGGACGATGTGGCCCGCGCGCCTC
GGAGCTCAGCCCGTCGCCGCACCTCCTCTTCCTCTTCGTTGTCCTCTCTTTCTTCGGGCTCAGG
TGCGGGTGGGGCCGCATCCCCTGGCTTCCTGTCTGCGAGCCCTCGCAGATTACTTACGTCCAAA
GGATCCTCTCTGCACCCTGCCCACTCCTCCCTAGAAGAAATGGCTTCTCTGCGGAAGGAAGCTT
GTAGCGTGAAGGTTGATTCTAAAGATAGTTCTTGTCGCTCTACGAACTCTGAATTTTCAACAGA
AGCTGAGGGTCAGAGTGATGCTATGGAGGAACCCAGCAAGTTCCAGAAAAGGAAGAAGGACAGG
CTTCAAGACCAGGGTTCAAGAATGATCTACCTGAAGGCCATCCAGGGCATCCTGGGGAAGTCGA
TGCCCAAGAGGAAGGGAGAGGCTGCCACCACTCAGGGGAAGGCAGGCTTGGGAGAGTATTCTAA
CCAGGAAGGACCAATCAAGAAGGTGGAAGGACCAGCCAGGAGTGTGGAAGGACCGACCAGGAGC
CAGGAAGAACTGGTCAAGAGCATAGAAGAAGGACCAGTCGGAAAGGTTACAGTTACTGTTCCTC
AGAAAGAGGAGTCGCATACAAAGGTTAGGGTGGAGAAGGAAGAGTCTACGCTAGACAGGAATAG
CTTTTGTGACAGAAGAGTGATTGTAGATTCTGTGAAGAAAACTAGTGAGGAACTGCTTGGTGAC
CGAAGGACAGTCATCGACAAACCCTCTCCAGCCCTAGAAATTTTTGATAACTCTGACTCTCATG
AAGGTGTTCAAAAGCACACAGACAGAGAGGTGGTGATGGAGTATCCCTCTTCAGGGAGCGACTG
GTCGGATGTGGATGAGCTGGCCACTGTGAGGTTCTCCCAAGAGGAACCTGTCTCACTGAAGTAC
TCAGCAGTTCCAGAGTCATCTTCCTTCCCAACTGACTATGTTATGTACCCTCCTCATTTGTATA
GTAGCCCCTGGTGTGACTATGCTAGCTATTGGACTAGCAGCCATAAGACACCTGGTTATCCATT
GGTGGAATCCAGCAGCCGTGACTCAGCACAGGCTGAGAAGAGCAGCCAGGATCGTCTGAGTGTT
CACTCCTCCAAGTCCACAGTGAGTACCCAGAGCATCTCCAAAGGGTTGGACATTTCCCATAAAA
GTAGGTCCCAGAATTCCCACTCACTTCAGTTCTCCAGAAGCATAGAGGAGAAGGAGGTGAAGGG
GAAGAGGGCATTCCAAGAGGAGACACCACTTCATCACACCAGAGAACACACATCTAGCTCTTTG
CCAAGGAGCCACCGGGAGCTGAGCCTGGAAGAGGGCTTCATTGATACCCACTGTCATCTGGACA
TGCTCTACTCCAAGCTGTCTTTCAAGGGGACCTTTACAAAGTTCAGAAAGATGTATAGTAGCTC
CTTCCCTAAGGAGTTTCAAGGCTGCATCTCTGACTTCTGTGATCCAAGGACACTGACTGATGGC
CTATGGGAGGAACTCCTGAAAGAAGATCTGGTTTGGGGAGCCTTTGGCTGTCACCCTCATTTTG
CACGATACTATAATGAGAGTCAAGAAAGAAAGCTTTTGCATGCCTTACGCCACCCCAAGGCTGT
GGCATTTGGGGAGATGGGCCTGGACTACTCTCACAAGTGCACCACACCAGTTCCGGAGCAGCAC
CAGGTGTTTGAGAGGCAGTTGCAGCTGGCTGTGTCTCTGAAGAAGCCCTTGGTAATTCACTGCC
GTGAAGCTGATGAAGATTTGTTGGACATCATGAAAAAATTTGTGCCCTCTGACTACAAGATCCA
TAGGCACTGCTTCACTGGCAGCTACTCAGTCATCGAGCCCTTGTTGAAGTACTTCCCTAACATG
TCGGTGGGCTTCACAGCAGTGGTGACCTACTCTTCCGCCTGGAAGGCTCGGGATGCCATCAGAC
AGATCCCGTTGGAGAGGATCATTGTGGAAACAGATGCACCCTACTTTCTCCCTCGCCAGGTGCC
GAGAAGTCTTTGCCAGTATGCCCATCCAGGCTTGGCCTTGCACACAGTTCGAGAGATTGCCAGG
GTCAAAGAGGAGTCACTTTCCCACACTCTGTCGGTCCTCCGAGAGAACACCAGTCGCCTCTACA
GTCTTTGAGCAGGAAACATGAGCAGGCACCTTCTGGCAAAGGATGACCAGTGGCCTGGTAGTAT
AGGACGGGCTCCCATCTGTTTGTGTCCAAGGTGAAGGATGTGTTGGAGATCCTGTCAAAACTCA
GCAAACCAGGATGTTACCTTGGAACCTCATCACAAGGCTTCACTTGCTGGTTGTTGGGCGGGCG
GGTACTGTGGAATGGATTTGAGGTGAGGAGTCCTTTCGCCTGCTGGCTACAAGGCTCCAGGGTA
ATTGGTGAACAACAGAAAGAAAAACATAACACAGAGTACAATGAGATGGTACCAGTCTGGATCG
CTGCCCTTTGGCCTGGGTTTCCCAGCAATCTGAATAAAGTCACCTCTTTATCTAAGCAC

hide sequence

RefSeq Acc Id:

XR_010065694

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,400,454 - 148,415,611 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102722	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL91556	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000030898
	ENSRNOP00000030898.5
	ENSRNOP00000097765.1

RefSeq Acc Id:

NP_001102722 ⟸ NM_001109252

- UniProtKB:

D3ZT26 (UniProtKB/TrEMBL), A6IBT8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASERRKVKYHWGSTSEGCPSKRSRPREPRNVAPSSRPGRRFASRPRGASSPQRLKVRRGDDVA
RAPRSSARRRTSSSSSLSSLSSGSGAGGAASPGFLSASPRRLLTSKGSSLHPAHSSLEEMASLR
KEACSVKVDSKDSSCRSTNSEFSTEAEGQSDAMEEPSKFQKRKKDRLQDQGSRMIYLKAIQGIL
GKSMPKRKGEAATTQGKAGLGEYSNQEGPIKKVEGPARSVEGPTRSQEELVKSIEEGPVGKVTV
TVPQKEESHTKVRVEKEESTLDRNSFCDRRVIVDSVKKTSEELLGDRRTVIDKPSPALEIFDNS
DSHEGVQKHTDREVVMEYPSSGSDWSDVDELATVRFSQEEPVSLKYSAVPESSSFPTDYVMYPP
HLYSSPWCDYASYWTSSHKTPGYPLVESSSRDSAQAEKSSQDRLSVHSSKSTVSTQSISKGLDI
SHKSRSQNSHSLQFSRSIEEKEVKGKRAFQEETPLHHTREHTSSSLPRSHRELSLEEGFIDTHC
HLDMLYSKLSFKGTFTKFRKMYSSSFPKEFQGCISDFCDPRTLTDGLWEELLKEDLVWGAFGCH
PHFARYYNESQERKLLHALRHPKAVAFGEMGLDYSHKCTTPVPEQHQVFERQLQLAVSLKKPLV
IHCREADEDLLDIMKKFVPSDYKIHRHCFTGSYSVIEPLLKYFPNMSVGFTAVVTYSSAWKARD
AIRQIPLERIIVETDAPYFLPRQVPRSLCQYAHPGLALHTVREIARVKEESLSHTLSVLRENTS
RLYSL

hide sequence

RefSeq Acc Id:

ENSRNOP00000030898 ⟸ ENSRNOT00000038964

RefSeq Acc Id:

ENSRNOP00000097765 ⟸ ENSRNOT00000118522

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZT26-F1-model_v2	AlphaFold	D3ZT26	1-773	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693313

Promoter ID:

EPDNEW_R3836

Type:

single initiation site

Name:

Tatdn2_1

Description:

TatD DNase domain containing 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	145,653,514 - 145,653,574	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1586017	AgrOrtholog
BioCyc Gene	G2FUF-43365	BioCyc
Ensembl Genes	ENSRNOG00000042482	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000038964	ENTREZGENE
	ENSRNOT00000038964.5	UniProtKB/TrEMBL
	ENSRNOT00000118522.1	UniProtKB/TrEMBL
Gene3D-CATH	Metal-dependent hydrolases	UniProtKB/TrEMBL
InterPro	DNase_TatD-rel	UniProtKB/TrEMBL
	DNase_TatD-rel_CS	UniProtKB/TrEMBL
	Metal_Hydrolase	UniProtKB/TrEMBL
KEGG Report	rno:500295	UniProtKB/TrEMBL
NCBI Gene	500295	ENTREZGENE
PANTHER	DEOXYRIBONUCLEASE TATDN2-RELATED	UniProtKB/TrEMBL
	DEOXYRIBONUCLEASE TATDN2-RELATED	UniProtKB/TrEMBL
Pfam	TatD_DNase	UniProtKB/TrEMBL
PhenoGen	Tatdn2	PhenoGen
PROSITE	TATD_1	UniProtKB/TrEMBL
	TATD_2	UniProtKB/TrEMBL
	TATD_3	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000042482	RatGTEx
Superfamily-SCOP	SSF51556	UniProtKB/TrEMBL
UniProt	A0A8I6B677_RAT	UniProtKB/TrEMBL
	A6IBT8	ENTREZGENE, UniProtKB/TrEMBL
	D3ZT26	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-05	Tatdn2	TatD DNase domain containing 2	LOC500295	similar to TatD DNase domain containing 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC500295	similar to TatD DNase domain containing 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar