Advanced Search (OLGA)

Gene: Mrps22 (mitochondrial ribosomal protein S22) Rattus norvegicus

Analyze

Symbol:

Mrps22

Name:

mitochondrial ribosomal protein S22

RGD ID:

1585674

Description:

Predicted to be a structural constituent of ribosome. Predicted to be located in mitochondrion and ribosome. Predicted to be part of mitochondrial small ribosomal subunit. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 5 and ovarian dysgenesis 7. Orthologous to human MRPS22 (mitochondrial ribosomal protein S22); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; aconitine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

28S ribosomal protein S22, mitochondrial; hypothetical protein LOC683519; LOC683519; similar to ribosomal protein, mitochondrial, S22; small ribosomal subunit protein mS22; uncharacterized protein LOC683519

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MRPS22 (mitochondrial ribosomal protein S22)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Mrps22 (mitochondrial ribosomal protein S22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mrps22 (mitochondrial ribosomal protein S22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MRPS22 (mitochondrial ribosomal protein S22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MRPS22 (mitochondrial ribosomal protein S22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mrps22 (mitochondrial ribosomal protein S22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MRPS22 (mitochondrial ribosomal protein S22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MRPS22 (mitochondrial ribosomal protein S22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mrps22 (mitochondrial ribosomal protein S22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mrps22 (mitochondrial ribosomal protein S22)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	MRPS22 (mitochondrial ribosomal protein S22)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mrps22 (mitochondrial ribosomal protein S22)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mrps22 (mitochondrial ribosomal protein S22)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mrps-22	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	mRpS22	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mrps22	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	108,063,468 - 108,076,638 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	108,063,471 - 108,076,638 (-)	Ensembl				GRCr8
mRatBN7.2	8	99,184,110 - 99,197,278 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	99,184,109 - 99,197,291 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	104,851,760 - 104,864,953 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	103,051,030 - 103,064,223 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	100,893,530 - 100,906,723 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	106,604,421 - 106,617,591 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	106,604,379 - 106,617,597 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	106,047,828 - 106,060,998 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	8	98,592,165 - 98,605,335 (-)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

46 XX gonadal dysgenesis (ISO)

Adult-Onset Muscular Dystrophy with Leukoencephalopathy (ISO)

Breast Neoplasms (ISO)

combined oxidative phosphorylation deficiency (ISO)

combined oxidative phosphorylation deficiency 1 (ISO)

combined oxidative phosphorylation deficiency 5 (ISO)

genetic disease (ISO)

mitochondrial metabolism disease (ISO)

ovarian dysgenesis 7 (ISO)

primary ovarian insufficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-phenylbutyric acid (ISO)

aconitine (EXP)

acrylamide (ISO)

aflatoxin B1 (EXP,ISO)

arsenite(3-) (ISO)

atrazine (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

buspirone (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

diclofenac (ISO)

dicrotophos (ISO)

dioxygen (ISO)

doxorubicin (ISO)

ethanol (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

ibuprofen (ISO)

indometacin (ISO)

ivermectin (ISO)

lipopolysaccharide (ISO)

microcystin RR (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

pirinixic acid (ISO)

quercetin (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

T-2 toxin (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichostatin A (ISO)

trimellitic anhydride (ISO)

tungsten (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

mitochondrial small ribosomal subunit (IBA,IEA,ISO)

mitochondrion (IEA,ISO)

ribosome (IEA)

Molecular Function

protein binding (ISO)

structural constituent of ribosome (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10938081	PMID:12477932	PMID:14651853	PMID:18614015

Genomics

Comparative Map Data

Mrps22
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	108,063,468 - 108,076,638 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	108,063,471 - 108,076,638 (-)	Ensembl				GRCr8
mRatBN7.2	8	99,184,110 - 99,197,278 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	99,184,109 - 99,197,291 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	104,851,760 - 104,864,953 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	103,051,030 - 103,064,223 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	100,893,530 - 100,906,723 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	106,604,421 - 106,617,591 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	106,604,379 - 106,617,597 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	106,047,828 - 106,060,998 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	8	98,592,165 - 98,605,335 (-)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

MRPS22
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	139,343,994 - 139,357,140 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	139,005,806 - 139,360,497 (+)	Ensembl			hg38	GRCh38
GRCh37	3	139,062,836 - 139,075,982 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	140,545,551 - 140,558,578 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	140,545,558 - 140,558,583	NCBI
Celera	3	137,485,814 - 137,498,839 (+)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI
HuRef	3	136,438,309 - 136,451,335 (+)	NCBI		HuRef
CHM1_1	3	139,026,426 - 139,039,453 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	142,091,547 - 142,104,693 (+)	NCBI		T2T-CHM13v2.0

Mrps22
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	98,470,783 - 98,483,732 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	98,470,783 - 98,483,713 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	98,588,730 - 98,601,679 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	98,588,730 - 98,601,660 (-)	Ensembl			mm10	GRCm38
MGSCv37	9	98,489,149 - 98,502,098 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	98,398,089 - 98,411,011 (-)	NCBI		MGSCv36	mm8
Celera	9	98,134,359 - 98,147,288 (-)	NCBI		Celera
Cytogenetic Map	9	E3.3	NCBI
cM Map	9	51.41	NCBI

Mrps22
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955508	6,232,514 - 6,246,633 (-)	Ensembl
ChiLan1.0	NW_004955508	6,232,514 - 6,246,593 (-)	NCBI	ChiLan1.0	ChiLan1.0

MRPS22
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	137,258,102 - 137,271,207 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	137,262,839 - 137,277,741 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	136,380,963 - 136,394,148 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	143,638,771 - 143,993,852 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	143,980,670 - 143,993,842 (+)	Ensembl			panPan2	panpan1.1

MRPS22
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	35,508,478 - 35,536,081 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	35,496,961 - 35,524,082 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	36,047,616 - 36,074,786 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	36,047,642 - 36,074,787 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	35,728,105 - 35,755,240 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	35,801,180 - 35,828,369 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	36,043,257 - 36,070,586 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mrps22
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	74,712,076 - 74,726,839 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936540	1,451,826 - 1,468,865 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936540	1,451,882 - 1,466,569 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MRPS22
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	79,981,796 - 80,232,773 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	80,006,656 - 80,232,107 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	87,874,586 - 87,894,354 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MRPS22
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	51,198,515 - 51,211,587 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	51,198,553 - 51,211,532 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	24,184,142 - 24,197,282 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mrps22
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	15,894,676 - 15,907,892 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	15,894,624 - 15,908,069 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mrps22
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	89,959,915 - 89,972,688 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mrps22
62 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	23
Count of miRNA genes:	19
Interacting mature miRNAs:	23
Transcripts:	ENSRNOT00000070953
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	105462581	132782436	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	63141536	109261840	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	82352698	127352698	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	63404444	108404444	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	80768445	125768445	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	80768445	125768445	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	70041301	121080908	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	68690349	119799881	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	84192326	129192326	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	102413464	132782436	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	103375781	129871912	Rat
71120	Niddm21	Non-insulin dependent diabetes mellitus QTL 21	3.73		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	8	66992095	111992095	Rat
8693654	Alc32	Alcohol consumption QTL 32	2	0.755	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	8	97492344	116428905	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	84192326	132782436	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	85348065	130348065	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	79394435	132782436	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	98145073	122898010	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	80768445	125768445	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	80768445	125768445	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	91340911	131690273	Rat

Markers in Region

AW529739

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	99,194,539 - 99,194,692 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	106,614,853 - 106,615,005	NCBI	Rnor6.0
Rnor_5.0	8	106,058,260 - 106,058,412	UniSTS	Rnor5.0
Celera	8	98,602,597 - 98,602,749	UniSTS
RH 3.4 Map	8	1051.89	UniSTS

BE119393

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	99,186,010 - 99,186,168 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	106,606,324 - 106,606,481	NCBI	Rnor6.0
Rnor_5.0	8	106,049,731 - 106,049,888	UniSTS	Rnor5.0
Celera	8	98,594,068 - 98,594,225	UniSTS
RH 3.4 Map	8	1052.0	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001077530	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC105629	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000070953 ⟹ ENSRNOP00000067192

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	108,063,471 - 108,076,638 (-)	Ensembl
mRatBN7.2 Ensembl	8	99,184,109 - 99,197,291 (-)	Ensembl
Rnor_6.0 Ensembl	8	106,604,379 - 106,617,597 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000160542 ⟹ ENSRNOP00000101791

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	108,063,471 - 108,076,638 (-)	Ensembl

RefSeq Acc Id:

NM_001077530 ⟹ NP_001070998

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	108,063,468 - 108,076,638 (-)	NCBI
mRatBN7.2	8	99,184,110 - 99,197,278 (-)	NCBI
Rnor_6.0	8	106,604,421 - 106,617,591 (-)	NCBI
Rnor_5.0	8	106,047,828 - 106,060,998 (-)	NCBI
Celera	8	98,592,165 - 98,605,335 (-)	RGD

Sequence:

show sequence

GGCAATCATGGCTGCAGTCAGATCTCCGTTGTCTCTGTGGAGGTTCCAGTTGAGCACTCGGCGA
GCACGGCGGGTCTGTACTCGGGTCGCAGCCCAGCGCCACTCCAATGCTCTGCTCGCGACGTGGT
CCCAGCCCTTTGAAGTGGGGCAGCCTCGCCGCCCTTTCAGCTCCGAGGCAGAATCTGGTAGCTC
AGAAGTCAAGAAACCTACTTTTATGGATGAGGAGGTCCAGAGCATCCTCACCAAGATGACAGGC
CTGGACTTGCAGAAGACTTTCAAGCCTGCTGTACAACCACTGAAGCCACCAACCTACAAGTTAA
TGACCCAGGCACAGCTGGAGGAGGCTACGAGACTGGCAGTTGAGGCAGCTAAAATACGATTAAA
GATGCCACCAGTTCTGGAAGAACGAAAGCCAATAAATGATGTGTTAGCCGAGGATAAGATCTTG
GAAGGAACAGAAACAAACAAATATGTGTTTACTGACATATCGTATAACATACCACACCGGGAAC
GTTTTATTGTTGTTAGAGAACCAAGTGGCACACTACGCAAAGCTTCATGGGAAGAACGGGACAG
GGTGATACAAATTTATTTCCCGAAAGAAGGTCGTAGAGTTTTGCCACCAGTAATTTTCAAAGAT
GAGAACCTTAAGACCATGTACAGCCAAGACCGGCATGCTGATGTCCTCAATCTCTGTGTTGCCC
AGTTTGAGCCAGATTCCACTGAGTATATCAAGGTTCATCACCAGACCTACGAAGATATAGACAG
ACATGGAAAATATGAGATTTTACGTTCAACAAGACACTTTGGTGGAATGGCTTGGTATTTGGTA
AATAACAAAAAGATCGATGGTTTGCTCATCGATCAGATCCAGAGAGACTTGGTTGATGATGCCA
CCAGCCTGGTCCAGCTGTACCACATGCTCCATCCAGAAGGCCAGTCAGCCCAAGAGGCCAAAGA
GCAGGCTGCTGAGGGAGTCAACTTAATTAAGGTCTTTGCAAAAACAGAAGCACAGAGAGGAGCA
TATATAGAATTAGCACTTCAAACTTATCAAGAAATAGTCATCAGCCATTCTGCAACATCCTGAG
AACAAGAATTCAAAATGCGTTTCATGTTAATGCCCTTCCATTTTGGTAATACTGAGCTGAACAT
TTAAAAATCTTGGAATTAAAAGGTATTTACTAACTTAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001070998	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05630	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000067192
	ENSRNOP00000067192.1
	ENSRNOP00000101791.1

RefSeq Acc Id:

NP_001070998 ⟸ NM_001077530

- UniProtKB:

Q0D2L2 (UniProtKB/TrEMBL), A6I2B7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAVRSPLSLWRFQLSTRRARRVCTRVAAQRHSNALLATWSQPFEVGQPRRPFSSEAESGSSEV
KKPTFMDEEVQSILTKMTGLDLQKTFKPAVQPLKPPTYKLMTQAQLEEATRLAVEAAKIRLKMP
PVLEERKPINDVLAEDKILEGTETNKYVFTDISYNIPHRERFIVVREPSGTLRKASWEERDRVI
QIYFPKEGRRVLPPVIFKDENLKTMYSQDRHADVLNLCVAQFEPDSTEYIKVHHQTYEDIDRHG
KYEILRSTRHFGGMAWYLVNNKKIDGLLIDQIQRDLVDDATSLVQLYHMLHPEGQSAQEAKEQA
AEGVNLIKVFAKTEAQRGAYIELALQTYQEIVISHSATS

hide sequence

Ensembl Acc Id:

ENSRNOP00000067192 ⟸ ENSRNOT00000070953

Ensembl Acc Id:

ENSRNOP00000101791 ⟸ ENSRNOT00000160542

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q0D2L2-F1-model_v2	AlphaFold	Q0D2L2	1-359	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696204

Promoter ID:

EPDNEW_R6728

Type:

multiple initiation site

Name:

Mrps22_1

Description:

mitochondrial ribosomal protein S22

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	106,617,604 - 106,617,664	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1585674	AgrOrtholog
BioCyc Gene	G2FUF-29415	BioCyc
Ensembl Genes	ENSRNOG00000047984	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000070953	ENTREZGENE
	ENSRNOT00000070953.4	UniProtKB/TrEMBL
	ENSRNOT00000160542.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7322855	IMAGE-MGC_LOAD
InterPro	Ribosomal_S22_mit	UniProtKB/TrEMBL
KEGG Report	rno:683519	UniProtKB/TrEMBL
MGC_CLONE	MGC:124995	IMAGE-MGC_LOAD
NCBI Gene	683519	ENTREZGENE
PANTHER	28S RIBOSOMAL PROTEIN S22, MITOCHONDRIAL	UniProtKB/TrEMBL
	PTHR13071	UniProtKB/TrEMBL
Pfam	MRP-S22	UniProtKB/TrEMBL
PhenoGen	Mrps22	PhenoGen
RatGTEx	ENSRNOG00000047984	RatGTEx
UniProt	A0ABK0LA12_RAT	UniProtKB/TrEMBL
	A6I2B7	ENTREZGENE, UniProtKB/TrEMBL
	Q0D2L2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-08-13	Mrps22	mitochondrial ribosomal protein S22	LOC683519	similar to ribosomal protein, mitochondrial, S22	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC683519	similar to ribosomal protein, mitochondrial, S22			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM