Advanced Search (OLGA)

Gene: Bend5 (BEN domain containing 5) Rattus norvegicus

Analyze

Symbol:

Bend5

Name:

BEN domain containing 5

RGD ID:

1584958

Description:

Predicted to enable metallocarboxypeptidase activity and tubulin binding activity. Predicted to be involved in defense response to virus and negative regulation of DNA-templated transcription. Predicted to act upstream of or within several processes, including axonal transport of mitochondrion; positive regulation of ubiquitin-dependent protein catabolic process; and regulation of blastocyst development. Predicted to be located in Golgi apparatus; cytosol; and microtubule organizing center. Orthologous to human BEND5 (BEN domain containing 5); INTERACTS WITH 6-propyl-2-thiouracil; acrylamide; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

BEN domain-containing protein 5; hypothetical LOC362564; LOC362564

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BEND5 (BEN domain containing 5)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Bend5 (BEN domain containing 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Bend5 (BEN domain containing 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101957772 (BEN domain-containing protein 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BEND5 (BEN domain containing 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Bend5 (BEN domain containing 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Bend5 (BEN domain containing 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Bend5 (BEN domain containing 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	BEND5 (BEN domain containing 5)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	bend5 (BEN domain containing 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG31019	Alliance	DIOPT (OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	bend5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	agbl4	Alliance	DIOPT (OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	agbl4	Alliance	DIOPT (OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	131,519,214 - 131,565,228 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	131,519,214 - 131,762,906 (+)	Ensembl				GRCr8
mRatBN7.2	5	126,290,648 - 126,336,662 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	125,254,956 - 126,534,367 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	128,945,420 - 128,991,409 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	130,668,505 - 130,714,494 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	130,696,701 - 130,742,690 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	131,257,127 - 131,312,335 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	131,257,127 - 131,312,335 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	135,084,714 - 135,138,954 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	132,955,337 - 133,001,386 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	124,998,399 - 125,044,805 (+)	NCBI		Celera
Cytogenetic Map	5	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

prostate cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

adefovir pivoxil (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

amphetamine (EXP)

amphotericin B (ISO)

antirheumatic drug (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (EXP)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

chloroacetaldehyde (ISO)

cidofovir anhydrous (ISO)

cisplatin (EXP,ISO)

clodronic acid (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

entinostat (ISO)

fonofos (ISO)

furan (EXP)

gentamycin (EXP)

isotretinoin (ISO)

methapyrilene (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

N-nitrosodiethylamine (EXP)

ozone (ISO)

paracetamol (EXP)

parathion (ISO)

perfluorooctanoic acid (EXP)

phenylmercury acetate (ISO)

pioglitazone (ISO)

quercetin (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tamoxifen (ISO)

terbufos (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

DNA-templated transcription (IEA)

negative regulation of DNA-templated transcription (IBA,IEA,ISO)

proteolysis (IEA)

Cellular Component

axon (IEA)

axon cytoplasm (IEA)

Golgi apparatus (ISO)

Molecular Function

DNA binding (IEA)

metallocarboxypeptidase activity (IEA)

protein binding (ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:17662146	PMID:23468431

Genomics

Comparative Map Data

Bend5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	131,519,214 - 131,565,228 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	131,519,214 - 131,762,906 (+)	Ensembl				GRCr8
mRatBN7.2	5	126,290,648 - 126,336,662 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	125,254,956 - 126,534,367 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	128,945,420 - 128,991,409 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	130,668,505 - 130,714,494 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	130,696,701 - 130,742,690 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	131,257,127 - 131,312,335 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	131,257,127 - 131,312,335 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	135,084,714 - 135,138,954 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	132,955,337 - 133,001,386 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	124,998,399 - 125,044,805 (+)	NCBI		Celera
Cytogenetic Map	5	q35	NCBI

BEND5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	48,727,519 - 48,776,891 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	48,727,519 - 48,776,969 (-)	Ensembl			hg38	GRCh38
GRCh37	1	49,193,191 - 49,242,563 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	48,966,129 - 49,015,090 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	1	47,479,547 - 47,528,540 (-)	NCBI		Celera
Cytogenetic Map	1	p33	NCBI
HuRef	1	47,312,301 - 47,361,290 (-)	NCBI		HuRef
CHM1_1	1	49,310,492 - 49,359,503 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	48,606,260 - 48,655,642 (-)	NCBI		T2T-CHM13v2.0

Bend5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	111,271,993 - 111,317,495 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	111,272,203 - 111,317,495 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	111,413,794 - 111,460,298 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	111,415,006 - 111,460,298 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	111,087,611 - 111,132,903 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	110,912,938 - 110,957,857 (+)	NCBI		MGSCv36	mm8
Celera	4	109,747,988 - 109,793,433 (+)	NCBI		Celera
Cytogenetic Map	4	D1	NCBI
cM Map	4	51.53	NCBI

Bend5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955464	9,952,128 - 9,999,732 (+)	Ensembl
ChiLan1.0	NW_004955464	9,952,128 - 9,997,938 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC101957772
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	63,573,607 - 64,269,801 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	29,599,327 - 29,647,228 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	29,600,130 - 29,647,142 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BEND5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	162,964,216 - 163,011,583 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	162,964,176 - 163,011,225 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

Bend5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624859	4,156,230 - 4,204,917 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624859	4,113,366 - 4,204,011 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Bend5
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	44,099,136 - 44,145,140 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Bend5
479 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	311
Count of miRNA genes:	200
Interacting mature miRNAs:	227
Transcripts:	ENSRNOT00000010628
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
2303586	Gluco52	Glucose level QTL 52	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	100826632	145826632	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	130678987	145274255	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
1582230	Bw78	Body weight QTL 78	3.2	0.0016	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	124314582	133270832	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	92583776	137583776	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	98972960	143972960	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
11528624	Bss114	Bone structure and strength QTL 114	6.54	3e-07	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	129627938	131996704	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
2303618	Vencon1	Ventilatory control QTL 1	3.8		respiration trait (VT:0001943)	oxygen consumption (CMO:0002169)	5	100826632	145826632	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	94034903	139034903	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	125969677	156302135	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	95062526	133270832	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	89369373	134369373	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	70969494	136328156	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	97492524	133270832	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	92881678	137881678	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	95062526	133270832	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Markers in Region

BE110236

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	126,206,402 - 126,206,554 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	131,173,147 - 131,173,298	NCBI	Rnor6.0
Rnor_5.0	5	135,000,798 - 135,000,949	UniSTS	Rnor5.0
RGSC_v3.4	5	132,869,270 - 132,869,421	UniSTS	RGSC3.4
Celera	5	124,914,680 - 124,914,831	UniSTS
RH 3.4 Map	5	821.5	UniSTS
Cytogenetic Map	5	q35	UniSTS

BF398772

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	126,296,801 - 126,296,921 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	131,263,281 - 131,263,400	NCBI	Rnor6.0
Rnor_5.0	5	135,090,868 - 135,090,987	UniSTS	Rnor5.0
RGSC_v3.4	5	132,961,491 - 132,961,610	UniSTS	RGSC3.4
Celera	5	125,004,553 - 125,004,672	UniSTS
RH 3.4 Map	9	55.0	UniSTS
Cytogenetic Map	5	q35	UniSTS

AU049333

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	126,296,934 - 126,297,064 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	131,263,414 - 131,263,543	NCBI	Rnor6.0
Rnor_5.0	5	135,091,001 - 135,091,130	UniSTS	Rnor5.0
RGSC_v3.4	5	132,961,624 - 132,961,753	UniSTS	RGSC3.4
Celera	5	125,004,686 - 125,004,869	UniSTS
Cytogenetic Map	5	q35	UniSTS

C1orf165

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	126,329,451 - 126,329,568 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	131,305,125 - 131,305,241	NCBI	Rnor6.0
Rnor_5.0	5	135,131,744 - 135,131,860	UniSTS	Rnor5.0
RGSC_v3.4	5	132,994,176 - 132,994,292	UniSTS	RGSC3.4
Celera	5	125,037,606 - 125,037,722	UniSTS
Cytogenetic Map	5	q35	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	9	67	150	90	89	58	91	58	6	351	188	11	129	81	92	31	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593492	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593493	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010548 ⟹ ENSRNOP00000010548

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	125,254,956 - 126,528,370 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000010628 ⟹ ENSRNOP00000010628

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	126,290,648 - 126,336,662 (+)	Ensembl
Rnor_6.0 Ensembl	5	131,257,127 - 131,312,335 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000044795 ⟹ ENSRNOP00000047761

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	125,341,986 - 125,361,474 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097800 ⟹ ENSRNOP00000088189

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	125,254,956 - 125,780,308 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110652 ⟹ ENSRNOP00000095635

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	125,254,956 - 126,437,854 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111569 ⟹ ENSRNOP00000089080

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	125,255,006 - 125,498,273 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112364 ⟹ ENSRNOP00000096707

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	125,254,956 - 126,336,662 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000115129 ⟹ ENSRNOP00000083032

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	126,326,704 - 126,336,662 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117438 ⟹ ENSRNOP00000097591

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	125,254,956 - 126,534,367 (+)	Ensembl

RefSeq Acc Id:

NM_001108672 ⟹ NP_001102142

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	131,519,214 - 131,565,228 (+)	NCBI
mRatBN7.2	5	126,290,648 - 126,336,662 (+)	NCBI
Rnor_6.0	5	131,257,127 - 131,312,335 (+)	NCBI
Rnor_5.0	5	135,084,714 - 135,138,954 (+)	NCBI
RGSC_v3.4	5	132,955,337 - 133,001,386 (+)	RGD
Celera	5	124,998,399 - 125,044,805 (+)	RGD

Sequence:

show sequence

AGCCGATTGGCAGAGCGGGGCTTTCAGGAACAATAACAGTGGGGGGAGCCGGGGCCCCGGGGAG
CCTCCCCGCCCCCGGCCCGGCTGCGGCTCACGCCCCTCTAGGGGTCCCCACCTCCGCGCCGCCC
CACGGGCTGACCGGCGCCCGGGCCCGCCCCCGGCGCCCACCATGTACGCCTTTGTGCGGTTCCT
GGAGGACAACGTCTGCTACGCGCTGCCCGTGTCGTGCGTGCGCGACTTCAGCCCCCGCTCGCGA
CTGGATTTTGACAACCAGAAGGTGTACGCGGTGTACCGGGGCCCGGAGGAGCTGGGCGTCGAGC
CCGAGAGCCCCCCGCGTACCCCTCGGGACTGGGGCGCGCTGTTGCTCCACAAGGCCCAGATCCT
GGCGCTGGCAGAAGACAAATCTGACCTTGAGAACAGTGTGATGCAGAAGAAAATAAAAATCCCC
AAACTTTCTCTCAGTCATGTAGAAGATGATGGGGAGGCTAAAGACTATGGGGAAGAAGATTTAC
AGCTTAGACACATCAAGAGACCGGAGGGGCGGAAGCCTAGTGAAGCGGCCCACAAGAGTATCGA
GGCAGTGGTGGCCCGGCTAGAGAGACAGAACGGCCTGAGCCTGGGCCATAGCACTTGTCCAGAA
GAGGTCTTTGTGGAGGCCTCAGCGGGCACAGAGGACATGGACAGTCTGGAGGATGCTGTCGTTC
CCCGGGCTCTGTATGAGGAGCTGCTGCGAAACTACCAGCAGCAACAAGAAGAGATGCGCCACCT
CCAGCAGGAGCTGGAGCGGACTCGGAGGCAGCTCGTACAGCAAGCCAAGAAGCTCAAGGAATAC
GGGGCATTGGTGTCTGAAATGAAGGAGCTCCGAGACCTCAACAGGAGACTCCAAGATGTGCTAC
TCCTACGCCTTGGCAGTGGTCCCGCCATTGACTTGGAAAAAGTAAAGTCAGAATGTCTCGAGCC
CGAGCCGGAGTTACGGAGCACTTTCAGTGAGGAAGCAAACACGTCGTCCTATTACCCCGCTCCT
GCGCCTGTCATGGACAAGTATATCCTAGACAATGGCAAGGTCCATCTGGGAAGCGGGATTTGGG
TTGACGAGGAGAAATGGCACCAGCTACAAGTTACCCAAGGAGATTCTAAGTACACGAAGAACTT
GGCAGTCATGATCTGGGGAACAGATGTTCTGAAAAACAGAAGTGTCACAGGAGTCGCCACAAAA
AAAAAGAAGGATGCAATCCCAAAGCCACCCCTCTCTCCTCATAAGCTAAGCATCGTCAGAGAGT
GTTTGTATGACAGAATAGCACAAGAAACGGTGGATGAAACGGAAATTGCACAGAGACTCTCCAA
AGTCAACAAGTACATCTGTGAGAAAATCATGGATATCAACAAATCTTGTAAAAATGAAGAACGA
AGGGAAGCAAAATACAATTTGCAATAAACTTTGAATTTTTTTCATAAGGCCTTTGCATTTTCTT
TGTGTGGTGTATGCATTTCGGGTGATGGTGCCATCCAAATAGACTACACCAGACATGGCTGTGT
CTGGGCAGGGGCCTTTAGGGCACTGAGGTCAGTGTCTGATTCTGAACTTGAATTCTGAACATGG
ACTTCCTACTTCACAGAAGGCAGATGGATTCACAGAGACTCAGCATCAGGCTCACCACAAGCCT
CATGCCATCGCCAGTGTTGTTGTGGAAAGGAAAAGCACTTTTTGCAGGGCTGTAAAGCATCAGA
GTAGCCTGTCGGGACCACAATACGAACTGTTATTTTTACCATTGGAGGACATCTATCTCTGCTC
CTCTATTTTGTTCTATAATAAAATTCCATTAATTATTGATGT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102142	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL90345	(Get FASTA)	NCBI Sequence Viewer
	EDL90346	(Get FASTA)	NCBI Sequence Viewer
	EDL90347	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010628
	ENSRNOP00000010628.6
	ENSRNOP00000098246.2

RefSeq Acc Id:

NP_001102142 ⟸ NM_001108672

- UniProtKB:

D3ZQP2 (UniProtKB/TrEMBL), A6JZ07 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MYAFVRFLEDNVCYALPVSCVRDFSPRSRLDFDNQKVYAVYRGPEELGVEPESPPRTPRDWGAL
LLHKAQILALAEDKSDLENSVMQKKIKIPKLSLSHVEDDGEAKDYGEEDLQLRHIKRPEGRKPS
EAAHKSIEAVVARLERQNGLSLGHSTCPEEVFVEASAGTEDMDSLEDAVVPRALYEELLRNYQQ
QQEEMRHLQQELERTRRQLVQQAKKLKEYGALVSEMKELRDLNRRLQDVLLLRLGSGPAIDLEK
VKSECLEPEPELRSTFSEEANTSSYYPAPAPVMDKYILDNGKVHLGSGIWVDEEKWHQLQVTQG
DSKYTKNLAVMIWGTDVLKNRSVTGVATKKKKDAIPKPPLSPHKLSIVRECLYDRIAQETVDET
EIAQRLSKVNKYICEKIMDINKSCKNEERREAKYNLQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000010628 ⟸ ENSRNOT00000010628

Ensembl Acc Id:

ENSRNOP00000095635 ⟸ ENSRNOT00000110652

Ensembl Acc Id:

ENSRNOP00000088189 ⟸ ENSRNOT00000097800

Ensembl Acc Id:

ENSRNOP00000096707 ⟸ ENSRNOT00000112364

Ensembl Acc Id:

ENSRNOP00000097591 ⟸ ENSRNOT00000117438

Ensembl Acc Id:

ENSRNOP00000089080 ⟸ ENSRNOT00000111569

Ensembl Acc Id:

ENSRNOP00000010548 ⟸ ENSRNOT00000010548

Ensembl Acc Id:

ENSRNOP00000047761 ⟸ ENSRNOT00000044795

Ensembl Acc Id:

ENSRNOP00000083032 ⟸ ENSRNOT00000115129

Protein Domains

BEN

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZQP2-F1-model_v2	AlphaFold	D3ZQP2	1-421	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1584958	AgrOrtholog
BioCyc Gene	G2FUF-40339	BioCyc
Ensembl Genes	ENSRNOG00000008025	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010628	ENTREZGENE
	ENSRNOT00000010628.9	UniProtKB/TrEMBL
	ENSRNOT00000120611.2	UniProtKB/TrEMBL
Gene3D-CATH	BEN domain	UniProtKB/TrEMBL
InterPro	BEN_domain	UniProtKB/TrEMBL
	BEND5	UniProtKB/TrEMBL
KEGG Report	rno:362564	UniProtKB/TrEMBL
NCBI Gene	362564	ENTREZGENE
PANTHER	BEN DOMAIN-CONTAINING PROTEIN 5	UniProtKB/TrEMBL
	PTHR14628	UniProtKB/TrEMBL
Pfam	BEN	UniProtKB/TrEMBL
PhenoGen	Bend5	PhenoGen
PROSITE	BEN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008025	RatGTEx
SMART	BEN	UniProtKB/TrEMBL
UniProt	A0ABK0L590_RAT	UniProtKB/TrEMBL
	A6JZ07	ENTREZGENE, UniProtKB/TrEMBL
	D3ZQP2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-11-11	Bend5	BEN domain containing 5	LOC362564	hypothetical LOC362564	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC362564	hypothetical LOC362564			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar