Advanced Search (OLGA)

Gene: Tesc (tescalcin) Rattus norvegicus

Analyze

Symbol:

Tesc

Name:

tescalcin

RGD ID:

1566317

Description:

Predicted to enable metal ion binding activity; phosphatase inhibitor activity; and protein homodimerization activity. Predicted to be involved in several processes, including positive regulation of macromolecule biosynthetic process; positive regulation of myeloid cell differentiation; and positive regulation of sodium:proton antiporter activity. Predicted to be located in several cellular components, including lamellipodium; nucleoplasm; and ruffle. Predicted to be active in cytoplasm; nucleus; and plasma membrane. Orthologous to human TESC (tescalcin); INTERACTS WITH 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil; 7,12-dimethyltetraphene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

calcineurin B homologous protein 3; LOC288689; RGD1566317; similar to Tescalcin

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TESC (tescalcin)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tesc (tescalcin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tesc (tescalcin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TESC (tescalcin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TESC (tescalcin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tesc (tescalcin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TESC (tescalcin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TESC (tescalcin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tesc (tescalcin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Tesc (tescalcin)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Tesc (tescalcin)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TESC (tescalcin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TESC (tescalcin)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	tesca (tescalcin a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tescb (tescalcin b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG14362	Alliance	DIOPT (Ensembl Compara\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG32812	Alliance	DIOPT (Ensembl Compara\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	tesc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	44,182,741 - 44,216,574 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	44,181,659 - 44,216,722 (-)	Ensembl				GRCr8
mRatBN7.2	12	38,521,832 - 38,555,665 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	38,521,861 - 38,555,824 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	39,697,181 - 39,730,981 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	40,310,977 - 40,344,777 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	39,363,938 - 39,397,741 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	12	45,461,054 - 45,494,824 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	12	45,377,330 - 45,411,100 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	12	44,250,343 - 44,284,113 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	12	54,702,457 - 54,736,229 (-)	NCBI		F344_StmMcwi
Rnor_6.0	12	44,141,258 - 44,174,701 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	44,141,422 - 44,174,583 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	45,972,890 - 46,006,329 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	39,669,706 - 39,704,041 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	40,180,191 - 40,225,489 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

Butylbenzyl phthalate (ISO)

C60 fullerene (EXP)

cadmium dichloride (ISO)

cantharidin (ISO)

carbon nanotube (ISO)

choline (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dibutyl phthalate (EXP)

diuron (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

ethanol (ISO)

folic acid (ISO)

genistein (ISO)

gentamycin (EXP)

GSK-J4 (ISO)

inulin (ISO)

ketamine (EXP)

L-methionine (ISO)

lipopolysaccharide (ISO)

methimazole (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

nickel atom (ISO)

nicotinic acid (EXP)

okadaic acid (ISO)

paracetamol (EXP)

paraquat (EXP)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (EXP,ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

Tetrachlorobisphenol A (ISO)

titanium dioxide (EXP,ISO)

trichostatin A (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IEA)

cellular response to retinoic acid (ISO)

male gonad development (ISO)

megakaryocyte development (ISO)

megakaryocyte differentiation (ISO)

negative regulation of cell population proliferation (ISO,ISS)

positive regulation of DNA-templated transcription (ISO,ISS)

positive regulation of gene expression (ISO,ISS)

positive regulation of granulocyte differentiation (IBA,ISO)

positive regulation of megakaryocyte differentiation (ISO,ISS)

positive regulation of sodium:proton antiporter activity (ISO)

protein localization to plasma membrane (IBA,ISO)

protein maturation (ISO)

protein stabilization (ISO)

regulation of cell adhesion mediated by integrin (IBA,ISO,ISS)

Cellular Component

cytoplasm (IBA,IEA,ISO)

cytosol (ISO)

lamellipodium (IEA,ISO,ISS)

membrane (IEA)

nucleoplasm (ISO)

nucleus (IBA,IEA,ISO,ISS)

plasma membrane (IBA,ISO,ISS)

ruffle (ISO)

ruffle membrane (IEA)

Molecular Function

calcium ion binding (IBA,IEA,ISO,ISS)

magnesium ion binding (ISO)

metal ion binding (IEA)

phosphatase inhibitor activity (IBA,ISO)

protein binding (ISO)

protein homodimerization activity (ISO)

protein kinase inhibitor activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11145610	PMID:11696366	PMID:14661968	PMID:17717601	PMID:18321853	PMID:19345287	PMID:20060826	PMID:21553168	PMID:22285131

Genomics

Comparative Map Data

Tesc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	44,182,741 - 44,216,574 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	44,181,659 - 44,216,722 (-)	Ensembl				GRCr8
mRatBN7.2	12	38,521,832 - 38,555,665 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	38,521,861 - 38,555,824 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	39,697,181 - 39,730,981 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	40,310,977 - 40,344,777 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	39,363,938 - 39,397,741 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	12	45,461,054 - 45,494,824 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	12	45,377,330 - 45,411,100 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	12	44,250,343 - 44,284,113 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	12	54,702,457 - 54,736,229 (-)	NCBI		F344_StmMcwi
Rnor_6.0	12	44,141,258 - 44,174,701 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	44,141,422 - 44,174,583 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	45,972,890 - 46,006,329 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	39,669,706 - 39,704,041 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	40,180,191 - 40,225,489 (-)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

TESC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	117,038,923 - 117,099,416 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	117,038,923 - 117,099,479 (-)	Ensembl			hg38	GRCh38
GRCh37	12	117,476,728 - 117,537,221 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	115,961,111 - 116,021,634 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	12	117,106,248 - 117,166,769 (-)	NCBI		Celera
Cytogenetic Map	12	q24.22	NCBI
HuRef	12	114,485,557 - 114,546,137 (-)	NCBI		HuRef
CHM1_1	12	117,444,429 - 117,505,233 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	117,019,980 - 117,080,464 (-)	NCBI		T2T-CHM13v2.0

Tesc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	118,165,808 - 118,199,943 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	118,165,808 - 118,199,943 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	118,027,743 - 118,061,878 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	118,027,743 - 118,061,878 (+)	Ensembl			mm10	GRCm38
MGSCv37	5	118,477,833 - 118,511,879 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	118,288,854 - 118,322,900 (+)	NCBI		MGSCv36	mm8
Celera	5	115,122,941 - 115,156,704 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	57.84	NCBI

Tesc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	14,053,443 - 14,092,637 (+)	Ensembl
ChiLan1.0	NW_004955455	14,053,918 - 14,092,637 (+)	NCBI	ChiLan1.0	ChiLan1.0

TESC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	125,099,855 - 125,160,624 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	125,096,237 - 125,157,013 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	114,615,155 - 114,675,932 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	117,991,047 - 118,051,370 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	117,991,047 - 118,051,346 (-)	Ensembl			panPan2	panpan1.1

TESC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	13,645,513 - 13,700,521 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	13,645,511 - 13,689,367 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	13,639,965 - 13,687,307 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	13,905,740 - 13,953,098 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	13,905,738 - 13,953,775 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	13,867,524 - 13,914,859 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	13,944,789 - 13,999,699 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	13,980,002 - 14,027,402 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tesc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	154,062,082 - 154,103,256 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936558	5,398,393 - 5,417,368 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936558	5,397,018 - 5,417,335 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TESC
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	35,381,923 - 35,439,253 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	35,381,899 - 35,452,215 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	37,601,263 - 37,658,113 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TESC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	112,331,123 - 112,410,901 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	112,327,906 - 112,410,849 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	132,669,841 - 132,746,806 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tesc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	16,188,949 - 16,228,211 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624747	16,189,032 - 16,228,211 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Tesc
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	35,769,878 - 35,803,187 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Tesc
261 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	168
Count of miRNA genes:	144
Interacting mature miRNAs:	161
Transcripts:	ENSRNOT00000001490
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	24805022	52308831	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	50386405	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	25989355	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	37764145	51558799	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	33700432	51558799	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	33700432	46784661	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	28717718	49212240	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	44139558	52308831	Rat

Markers in Region

RH128260

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	38,571,133 - 38,571,347 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	44,244,749 - 44,244,962	NCBI	Rnor6.0
Rnor_5.0	12	46,075,312 - 46,075,525	UniSTS	Rnor5.0
RGSC_v3.4	12	39,719,946 - 39,720,159	UniSTS	RGSC3.4
Celera	12	40,229,333 - 40,229,546	UniSTS
RH 3.4 Map	12	707.9	UniSTS
Cytogenetic Map	12	q16	UniSTS

AU048529

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	12	44,224,499 - 44,224,725 (+)	Marker Load Pipeline
mRatBN7.2	12	38,563,599 - 38,563,825 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	44,237,215 - 44,237,440	NCBI	Rnor6.0
Rnor_5.0	12	46,067,778 - 46,068,003	UniSTS	Rnor5.0
RGSC_v3.4	12	39,712,412 - 39,712,637	UniSTS	RGSC3.4
Celera	12	40,221,800 - 40,222,025	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	154	89	88	57	92	57	6	354	192	11	132	81	92	31	11	11

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001398612	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006249426	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017604544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039090179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039090180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001490 ⟹ ENSRNOP00000001490

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	44,182,741 - 44,209,281 (-)	Ensembl
mRatBN7.2 Ensembl	12	38,521,861 - 38,540,659 (-)	Ensembl
Rnor_6.0 Ensembl	12	44,141,422 - 44,174,583 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094481 ⟹ ENSRNOP00000078044

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	44,182,741 - 44,201,344 (-)	Ensembl
mRatBN7.2 Ensembl	12	38,521,861 - 38,539,402 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104891 ⟹ ENSRNOP00000092418

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	44,182,741 - 44,216,722 (-)	Ensembl
mRatBN7.2 Ensembl	12	38,521,861 - 38,540,535 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114089 ⟹ ENSRNOP00000088101

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	44,182,741 - 44,201,753 (-)	Ensembl
mRatBN7.2 Ensembl	12	38,523,303 - 38,555,824 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000130447 ⟹ ENSRNOP00000101666

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	44,182,741 - 44,201,344 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000133241 ⟹ ENSRNOP00000107159

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	44,182,741 - 44,201,344 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000148974 ⟹ ENSRNOP00000099700

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	44,181,659 - 44,216,540 (-)	Ensembl

RefSeq Acc Id:

NM_001398612 ⟹ NP_001385541

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	44,182,741 - 44,216,540 (-)	NCBI
mRatBN7.2	12	38,521,832 - 38,555,639 (-)	NCBI
Dahl_SR_JrHsd	12	45,461,054 - 45,494,824 (-)	NCBI
Lyon_Normotensive	12	45,377,330 - 45,411,100 (-)	NCBI
Lyon_Hypertensive	12	44,250,343 - 44,284,113 (-)	NCBI
F344_StmMcwi	12	54,702,457 - 54,736,229 (-)	NCBI

RefSeq Acc Id:

XM_006249426 ⟹ XP_006249488

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	44,182,749 - 44,216,574 (-)	NCBI
mRatBN7.2	12	38,521,839 - 38,555,665 (-)	NCBI
Rnor_6.0	12	44,141,258 - 44,174,701 (-)	NCBI
Rnor_5.0	12	45,972,890 - 46,006,329 (-)	NCBI

Sequence:

show sequence

CGAGCCCCACGCGGAACCGGCTCCGTGCCGCTGTCCCCGCGTCTCCACCGGGCTCGAGCTCAGC
GCAGCCCAGGCAGTCCCCGTCCTGCGTGGGGCGCCCGGGGCCCCGCGGCGCACCATGGGCGCTG
CCCACTCGGCGTCCGAGGAGGTGCGGGAGCTCGAGGGCAAGACCGGTTTCTCCTCGGACCAGAT
AGAGCAACTGCACCGGAGGTTCAAGCAGCTAAGCGGAGACCAGCCCACCATTCGACTCTGCAGC
TCTCGTCTCTGCAGTGTGAGGAGTGTGAGTGTGCCACCCACCTCTCAGCTTCCTCTAAGTGTCA
AGCTCCAGTGGCGCCCAGTCTGTAGCAAGGAGAACTTTAACAATGTACCTGACCTGGAGCTCAA
CCCGATCCGATCCAAAATCGTCCGTGCCTTCTTCGACAACAGGAACCTGCGTAAGGGGTCCAGC
GGCCTGGCCGATGAGATCAACTTCGAGGACTTCCTGACTATCATGTCCTACTTCCGGCCCATTG
ACACTACCCTGGGTGAGGAACAAGTGGAGCTGTCTCGGAAGGAGAAGCTGAAATTTCTGTTCCA
TATGTATGACTCGGACAGTGACGGCCGCATCACCCTGGAAGAGTATCGAAATGTGGTGGAGGAA
CTGCTCTCTGGAAATCCTCACATCGAGAAGGAGTCAGCTCGGTCCATCGCCGACGGAGCCATGA
TGGAGGCTGCCAGCGTGTGCGTGGGACAGATGGAACCGGACCAGGTGTACGAGGGGATCACCTT
TGAGGACTTCCTGAAGATCTGGCAGGGCATCGACATCGAGACCAAGATGCACATCCGCTTCCTC
AACATGGAGACCATTGCCCTCTGCCACTGATCGTGCAGGGGAGGGGGTGGCTAAGGACCGAGGT
TCAGCCCTTTGTCTGGGCTGCTGTGACAATCAGTAACCCTTCAGTTAGCCTCCTTGTGTGGTGT
GGCGTGTGGGACTCCGATGTTTTTATCTCTAATGGTGACAATAAAGGTTTCCTAATGAGCCCGG
CA

hide sequence

RefSeq Acc Id:

XM_039090179 ⟹ XP_038946107

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	44,182,749 - 44,198,874 (-)	NCBI
mRatBN7.2	12	38,521,840 - 38,537,968 (-)	NCBI

RefSeq Acc Id:

XM_039090180 ⟹ XP_038946108

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	44,182,749 - 44,198,874 (-)	NCBI
mRatBN7.2	12	38,521,840 - 38,537,968 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001385541	(Get FASTA)	NCBI Sequence Viewer
	XP_006249488	(Get FASTA)	NCBI Sequence Viewer
	XP_038946107	(Get FASTA)	NCBI Sequence Viewer
	XP_038946108	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM13813	(Get FASTA)	NCBI Sequence Viewer
	EDM13814	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001490
	ENSRNOP00000001490.6
	ENSRNOP00000078044.2
	ENSRNOP00000088101
	ENSRNOP00000088101.2
	ENSRNOP00000092418.2
	ENSRNOP00000099700
	ENSRNOP00000099700.1
	ENSRNOP00000101666.1
	ENSRNOP00000107159.1

RefSeq Acc Id:

XP_006249488 ⟸ XM_006249426

- Peptide Label:

isoform X1

- Sequence:

show sequence

MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRLCSSRLCSVRSVSVPPTSQLP
LSVKLQWRPVCSKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGSSGLADEINFEDFLTIMSYF
RPIDTTLGEEQVELSRKEKLKFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIAD
GAMMEAASVCVGQMEPDQVYEGITFEDFLKIWQGIDIETKMHIRFLNMETIALCH

hide sequence

Ensembl Acc Id:

ENSRNOP00000001490 ⟸ ENSRNOT00000001490

RefSeq Acc Id:	XP_038946108 ⟸ XM_039090180
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6AI44 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038946107 ⟸ XM_039090179
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6AI44 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000088101 ⟸ ENSRNOT00000114089

Ensembl Acc Id:

ENSRNOP00000078044 ⟸ ENSRNOT00000094481

Ensembl Acc Id:

ENSRNOP00000092418 ⟸ ENSRNOT00000104891

RefSeq Acc Id:	NP_001385541 ⟸ NM_001398612
- UniProtKB:	A0A8I6AI44 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000099700 ⟸ ENSRNOT00000148974

Ensembl Acc Id:

ENSRNOP00000107159 ⟸ ENSRNOT00000133241

Ensembl Acc Id:

ENSRNOP00000101666 ⟸ ENSRNOT00000130447

Protein Domains

EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZTN1-F1-model_v2	AlphaFold	D3ZTN1	1-214	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1566317	AgrOrtholog
BioCyc Gene	G2FUF-19074	BioCyc
Ensembl Genes	ENSRNOG00000001128	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001490	ENTREZGENE
	ENSRNOT00000001490.8	UniProtKB/TrEMBL
	ENSRNOT00000094481.2	UniProtKB/TrEMBL
	ENSRNOT00000104891.2	UniProtKB/TrEMBL
	ENSRNOT00000114089	ENTREZGENE
	ENSRNOT00000114089.2	UniProtKB/TrEMBL
	ENSRNOT00000130447.1	UniProtKB/TrEMBL
	ENSRNOT00000133241.1	UniProtKB/TrEMBL
	ENSRNOT00000148974	ENTREZGENE
	ENSRNOT00000148974.1	UniProtKB/TrEMBL
Gene3D-CATH	EF-hand	UniProtKB/TrEMBL
InterPro	CHP3	UniProtKB/TrEMBL
	EF-hand-like_dom	UniProtKB/TrEMBL
	EF_Hand_1_Ca_BS	UniProtKB/TrEMBL
	EF_hand_Ca-bd	UniProtKB/TrEMBL
NCBI Gene	288689	ENTREZGENE
PANTHER	CALCINEURIN B HOMOLOGOUS PROTEIN 3	UniProtKB/TrEMBL
Pfam	EF-hand_1	UniProtKB/TrEMBL
	EF-hand_6	UniProtKB/TrEMBL
PhenoGen	Tesc	PhenoGen
PROSITE	EF_HAND_1	UniProtKB/TrEMBL
	EF_HAND_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001128	RatGTEx
SMART	EFh	UniProtKB/TrEMBL
Superfamily-SCOP	SSF47473	UniProtKB/TrEMBL
UniProt	A0A8I5Y9W2_RAT	UniProtKB/TrEMBL
	A0A8I6A929_RAT	UniProtKB/TrEMBL
	A0A8I6AI44	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LE29_RAT	UniProtKB/TrEMBL
	A0ABK0LJW1_RAT	UniProtKB/TrEMBL
	A0ABK0LN98_RAT	UniProtKB/TrEMBL
	A6J1M4_RAT	UniProtKB/TrEMBL
	D3ZTN1_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-07	Tesc	tescalcin	RGD1566317_predicted	similar to Tescalcin (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1566317_predicted	similar to Tescalcin (predicted)	LOC288689	similar to Tescalcin	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC288689	similar to Tescalcin			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message