Advanced Search (OLGA)

Gene: Ccny (cyclin Y) Rattus norvegicus

Analyze

Symbol:

Ccny

Name:

cyclin Y

RGD ID:

1565969

Description:

Predicted to enable cyclin-dependent protein serine/threonine kinase regulator activity. Predicted to be involved in G2/M transition of mitotic cell cycle; positive regulation of autophagy; and regulation of canonical Wnt signaling pathway. Predicted to be part of cytoplasmic cyclin-dependent protein kinase holoenzyme complex. Predicted to be active in plasma membrane. Orthologous to human CCNY (cyclin Y); INTERACTS WITH 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

cyclin-Y; LOC361261; RGD1565969; similar to 5730405I09Rik protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CCNY (cyclin Y)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, Panther
Mus musculus (house mouse):	Ccny (cyclin Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ccny (cyclin Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CCNY (cyclin Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CCNY (cyclin Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ccny (cyclin Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CCNY (cyclin Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CCNY (cyclin Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ccny (cyclin Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ccny (cyclin Y)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CCNY (cyclin Y)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ccny (cyclin Y)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ccny (cyclin Y)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ccny (cyclin Y)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ccny (cyclin Y)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CycY	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CycY	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cyy-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cyy-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SIP3	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Saccharomyces cerevisiae (baker's yeast):	LAM1	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	ccny	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	ccny	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	62,079,925 - 62,207,780 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	62,079,925 - 62,207,979 (-)	Ensembl				GRCr8
mRatBN7.2	17	57,385,002 - 57,512,860 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	57,384,176 - 57,522,378 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	60,548,512 - 60,676,637 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	64,551,533 - 64,679,727 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	58,705,684 - 58,833,921 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	62,332,537 - 62,462,644 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	62,332,537 - 62,462,644 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	64,106,292 - 64,238,150 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	66,039,497 - 66,168,042 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	58,665,541 - 58,793,343 (-)	NCBI		Celera
Cytogenetic Map	17	q12.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Crohn's disease (ISO)

ulcerative colitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amitrole (EXP)

amphetamine (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

cadmium dichloride (EXP)

caffeine (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

deoxynivalenol (ISO)

Dibutyl phosphate (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (ISO)

finasteride (EXP)

folic acid (ISO)

FR900359 (ISO)

fulvestrant (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

ivermectin (ISO)

L-methionine (ISO)

methapyrilene (ISO)

methimazole (EXP)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

potassium chromate (ISO)

Salinomycin (ISO)

SB 431542 (ISO)

succimer (ISO)

sulfadimethoxine (EXP)

testosterone (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G2/M transition of mitotic cell cycle (ISO)

positive regulation of autophagy (ISO)

positive regulation of cyclin-dependent protein serine/threonine kinase activity (ISO)

regulation of canonical Wnt signaling pathway (IBA,ISO)

Wnt signaling pathway (IEA)

Cellular Component

cyclin-dependent protein kinase holoenzyme complex (IEA,ISO)

cytoplasmic cyclin-dependent protein kinase holoenzyme complex (IBA,ISO)

nucleolus (ISO)

nucleoplasm (ISO)

nucleus (ISO)

plasma membrane (IBA,ISO)

Molecular Function

cyclin-dependent protein serine/threonine kinase activator activity (IBA)

cyclin-dependent protein serine/threonine kinase regulator activity (ISO)

protein binding (ISO)

protein kinase binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:19524571	PMID:20059949	PMID:23376485	PMID:26220330	PMID:28241067

Genomics

Comparative Map Data

Ccny
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	62,079,925 - 62,207,780 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	62,079,925 - 62,207,979 (-)	Ensembl				GRCr8
mRatBN7.2	17	57,385,002 - 57,512,860 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	57,384,176 - 57,522,378 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	60,548,512 - 60,676,637 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	64,551,533 - 64,679,727 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	58,705,684 - 58,833,921 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	62,332,537 - 62,462,644 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	62,332,537 - 62,462,644 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	64,106,292 - 64,238,150 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	66,039,497 - 66,168,042 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	58,665,541 - 58,793,343 (-)	NCBI		Celera
Cytogenetic Map	17	q12.1	NCBI

CCNY
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	35,247,025 - 35,572,667 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	35,247,025 - 35,572,669 (+)	Ensembl			hg38	GRCh38
GRCh37	10	35,535,953 - 35,861,595 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	35,575,959 - 35,899,164 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	35,575,958 - 35,898,672	NCBI
Celera	10	35,301,299 - 35,625,598 (+)	NCBI		Celera
Cytogenetic Map	10	p11.21	NCBI
HuRef	10	35,254,369 - 35,578,459 (+)	NCBI		HuRef
CHM1_1	10	35,536,901 - 35,860,352 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	35,275,620 - 35,601,106 (+)	NCBI		T2T-CHM13v2.0

Ccny
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	9,312,304 - 9,450,188 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	9,312,304 - 9,450,154 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	18	9,312,304 - 9,450,154 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	9,312,304 - 9,450,154 (-)	Ensembl			mm10	GRCm38
MGSCv37	18	9,314,042 - 9,450,148 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	18	9,314,042 - 9,450,148 (-)	NCBI		MGSCv36	mm8
Celera	18	9,350,201 - 9,486,604 (-)	NCBI		Celera
Cytogenetic Map	18	A1	NCBI
cM Map	18	4.91	NCBI

Ccny
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955462	5,937,292 - 6,088,310 (-)	Ensembl
ChiLan1.0	NW_004955462	5,937,292 - 6,088,310 (-)	NCBI	ChiLan1.0	ChiLan1.0

CCNY
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	47,888,595 - 48,218,928 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	47,895,744 - 48,224,256 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	35,458,092 - 35,698,142 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	35,950,490 - 36,273,282 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	36,035,729 - 36,273,282 (+)	Ensembl			panPan2	panpan1.1

CCNY
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	1,387,962 - 1,720,497 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	1,390,082 - 1,720,357 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	1,476,374 - 1,808,633 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	1,670,014 - 2,003,475 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	1,671,101 - 1,919,834 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	1,441,682 - 1,774,513 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	1,484,477 - 1,818,050 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	1,605,744 - 1,938,890 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ccny
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	14,138,557 - 14,349,544 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936574	3,638,048 - 3,849,736 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936574	3,638,054 - 3,849,154 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CCNY
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	57,929,244 - 58,086,872 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	10	57,929,484 - 58,057,964 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	10	63,625,440 - 63,709,347 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CCNY
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	34,626,185 - 34,847,835 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	34,626,323 - 34,848,918 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666056	43,780,187 - 44,014,772 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ccny
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624805	10,033,112 - 10,199,398 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ccny
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	26,599,289 - 26,703,225 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ccny
876 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	28
Count of miRNA genes:	27
Interacting mature miRNAs:	27
Transcripts:	ENSRNOT00000024545
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	49496932	65155015	Rat
70210	Cm15	Cardiac mass QTL 15	6.5		heart right ventricle mass (VT:0007033)	heart right ventricle wet weight (CMO:0000072)	17	30066472	75066472	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	42388164	87388164	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	58194064	87388164	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	33104645	78104645	Rat
1354654	Spl7	Serum phospholipid level QTL 7	5.5		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	17	38031354	83031354	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	54829503	93515804	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40968017	89341781	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27233445	83975845	Rat
1354629	Scl31	Serum cholesterol level QTL 31	4.1		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	17	38031354	83031354	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23286322	64246472	Rat
1600398	Edcs5	Endometrial carcinoma susceptibility QTL 5	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	17	35446949	75762341	Rat
2317045	Aia11	Adjuvant induced arthritis QTL 11	4.06		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	26522051	71522051	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	22019705	67019705	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24390595	84432719	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	38031354	83031354	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	38031354	83031354	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	33104645	78104645	Rat
12904736	Cm121	Cardiac mass QTL 121		0.043	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	42388164	87388164	Rat
7394837	Memor18	Memory QTL 18			exploratory behavior trait (VT:0010471)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	17	61091446	68550213	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	46050126	91050126	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23858926	68858926	Rat
4889891	Eae32	Experimental allergic encephalomyelitis QTL 32	4.8	0.0002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	27233445	72233445	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27233445	65155015	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23858926	68858926	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23858926	68858926	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	55604597	93006569	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	42654895	87654895	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23858926	68858926	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	37687877	82687877	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23858926	68858926	Rat
1300129	Rf25	Renal function QTL 25	3.03		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	17	41062352	86062352	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	32199534	86201342	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			24136127	84432719	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	36045537	81045537	Rat

Markers in Region

RH137311

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	57,384,843 - 57,385,023 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	62,332,379 - 62,332,558	NCBI	Rnor6.0
Rnor_5.0	17	64,106,134 - 64,106,313	UniSTS	Rnor5.0
RGSC_v3.4	17	66,039,339 - 66,039,518	UniSTS	RGSC3.4
Celera	17	58,665,383 - 58,665,562	UniSTS
RH 3.4 Map	17	608.3	UniSTS
Cytogenetic Map	17	q12.1	UniSTS

ha3046

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	57,421,918 - 57,423,478 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	62,369,201 - 62,370,760	NCBI	Rnor6.0
Rnor_5.0	17	64,142,956 - 64,144,515	UniSTS	Rnor5.0
RGSC_v3.4	17	66,076,435 - 66,077,994	UniSTS	RGSC3.4
Celera	17	58,702,457 - 58,704,016	UniSTS
Cytogenetic Map	17	q12.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	162	91	90	59	92	59	6	356	192	11	141	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191833	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474080	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024545 ⟹ ENSRNOP00000024545

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	62,079,925 - 62,207,780 (-)	Ensembl
mRatBN7.2 Ensembl	17	57,384,176 - 57,512,860 (-)	Ensembl
Rnor_6.0 Ensembl	17	62,332,537 - 62,462,644 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099842 ⟹ ENSRNOP00000082775

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	62,079,925 - 62,207,979 (-)	Ensembl
mRatBN7.2 Ensembl	17	57,385,002 - 57,522,378 (-)	Ensembl

RefSeq Acc Id:

NM_001191833 ⟹ NP_001178762

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	62,079,925 - 62,207,780 (-)	NCBI
mRatBN7.2	17	57,385,002 - 57,512,860 (-)	NCBI
Rnor_6.0	17	62,332,537 - 62,462,644 (-)	NCBI
Rnor_5.0	17	64,106,292 - 64,238,150 (-)	NCBI
Celera	17	58,665,541 - 58,793,343 (-)	NCBI

Sequence:

show sequence

ATGGGGAACACAACTTCGTGCTGCGTGTCGTCCAGCCCTAAGCTCCGGAGGAATGCGCACTCGC
GGCTGGAGTCCTACCGCCCGGACACGGACCTCAGCCGCGAGGACACTGGCTGCAATCTGCAGCA
CATCAGCGACCGGGAAAACATCGACGATTTAAACATGGAATTCAATCCTTCAGACCATCCTCGG
GCCAGCACAATATTCCTCAGCAAATCTCAGACAGACGTGAGAGAAAAACGAAAGAGTCTCTTCA
TTAACCATCATCCTCCAGGGCAGACATCAAGGAAATACAGTTCCTGCTCCACCATCTTTCTAGA
CGACAGCACAGTCAGCCAGCCAAACCTCAAGTACACCATCAAATGTGTAGCTCTTGCGATATAT
TACCACATCAAAAACAGGGACCCAGATGGAAGGATGCTCTTAGATATTTTTGATGAAAACCTCC
ACCCTCTTTCGAAATCCGAAGTGCCACCAGATTATGACAAACACAACCCAGAGCAGAAGCAGAT
TTACCGGTTCGTTCGGACACTGTTCAGTGCTGCTCAGCTGACAGCTGAATGTGCCATTGTCACC
CTGGTATACCTTGAAAGGCTCTTGACATATGCAGAGATTGACATTTGTCCAGCCAATTGGAAGC
GCATTGTTCTAGGAGCTATCCTGCTGGCCTCTAAGGTGTGGGATGACCAGGCTGTGTGGAATGT
GGACTACTGCCAGATCCTGAAAGACATCACAGTGGAGGACATGAATGAACTGGAACGCCAGTTC
CTTGAATTGCTACAGTTTAACATCAATGTTCCTTCCAGTGTGTATGCCAAGTATTATTTTGATC
TGCGTTCTCTGGCAGAAGCAAACAGCCTGAGCTTTCCTCTGGAGCCCCTGAGCAGGGAGCGTGC
CCACAAGCTGGAGGCCATCTCTCGTCTCTGTGAGGACAAGTACAAGGACCTCAGAAAACCCATG
AGGAAGCGTTCAGCAAGTGCTGACAACCTGATTCTGCCTCGGTGGTCCCCAGCCATCATCTCCT
AACTGGGGCACTCTCCTGAGGCCATGCCGTCCCTCATCTTCTCCTTTTGTTTAAGAAAAGATGA
ACTTGGATGGTTTGGTTTGGTTTGGTTTTCTTTTTTCCTTCTGTTTTTAACGCAGCCCCGTCAA
GGCTGCCTTCACACCCACCTCCACGTTGCGTGGGTGTACACAAAGAGGCTTTAAGGGACGTAAA
ATCAGTATTCAGGAAACTCGGTGTCAAGCCTTCGCAGCAGTCACCAACAGCGCTTCTTTCATGG
AGGAAACAGACTCTAATCCTGGAGAAGGAAATGAAGGAAAAGGAAGTTGTGTTGAGGCAAAGAT
TAGTTGGGAGCTTTGCTGTTTCTGGGTTTCTGTCTGGTCATAGACACCAGATGGAGGCAGATGG
TAGGTAGCAGAGTTGAAGGCACCTCCAAATCCGGAATGCCATGCTATG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001178762	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL83778	(Get FASTA)	NCBI Sequence Viewer
	EDL83779	(Get FASTA)	NCBI Sequence Viewer
	EDL83780	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024545.5
	ENSRNOP00000082775
	ENSRNOP00000082775.1

RefSeq Acc Id:

NP_001178762 ⟸ NM_001191833

- UniProtKB:

F1MA89 (UniProtKB/TrEMBL), A0A8I5ZU57 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGNTTSCCVSSSPKLRRNAHSRLESYRPDTDLSREDTGCNLQHISDRENIDDLNMEFNPSDHPR
ASTIFLSKSQTDVREKRKSLFINHHPPGQTSRKYSSCSTIFLDDSTVSQPNLKYTIKCVALAIY
YHIKNRDPDGRMLLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVT
LVYLERLLTYAEIDICPANWKRIVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQF
LELLQFNINVPSSVYAKYYFDLRSLAEANSLSFPLEPLSRERAHKLEAISRLCEDKYKDLRKPM
RKRSASADNLILPRWSPAIIS

hide sequence

Ensembl Acc Id:

ENSRNOP00000024545 ⟸ ENSRNOT00000024545

Ensembl Acc Id:

ENSRNOP00000082775 ⟸ ENSRNOT00000099842

Protein Domains

Cyclin-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1MA89-F1-model_v2	AlphaFold	F1MA89	1-341	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565969	AgrOrtholog
BioCyc Gene	G2FUF-8948	BioCyc
Ensembl Genes	ENSRNOG00000018123	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024545.6	UniProtKB/TrEMBL
	ENSRNOT00000099842	ENTREZGENE
	ENSRNOT00000099842.2	UniProtKB/TrEMBL
Gene3D-CATH	Cyclin-like	UniProtKB/TrEMBL
InterPro	Cyclin-like	UniProtKB/TrEMBL
	Cyclin-like_sf	UniProtKB/TrEMBL
	Cyclin_N	UniProtKB/TrEMBL
	Cyclin_Y	UniProtKB/TrEMBL
KEGG Report	rno:361261	UniProtKB/TrEMBL
NCBI Gene	361261	ENTREZGENE
PANTHER	CYCLIN Y, ISOFORM A	UniProtKB/TrEMBL
Pfam	Cyclin_N	UniProtKB/TrEMBL
PhenoGen	Ccny	PhenoGen
PIRSF	Cyclin_CG14939	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018123	RatGTEx
SMART	CYCLIN	UniProtKB/TrEMBL
Superfamily-SCOP	Cyclin_like	UniProtKB/TrEMBL
UniProt	A0A8I5ZU57	ENTREZGENE, UniProtKB/TrEMBL
	F1MA89	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Ccny	cyclin Y	RGD1565969_predicted	similar to 5730405I09Rik protein (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1565969_predicted	similar to 5730405I09Rik protein (predicted)	LOC361261	similar to 5730405I09Rik protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC361261	similar to 5730405I09Rik protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD