Symbol:
Nkap
Name:
NFKB activating protein
RGD ID:
1565955
Description:
Predicted to enable chromatin DNA binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II and positive regulation of alpha-beta T cell differentiation. Predicted to act upstream of or within hemopoiesis and somatic stem cell population maintenance. Predicted to be located in cytosol and nucleoplasm. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in syndromic X-linked intellectual disability. Orthologous to human NKAP (NFKB activating protein); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
2610020o08rik; NF-kappa-B-activating protein; nuclear NF-kappaB activating protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NKAP (NFKB activating protein) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Nkap (NFKB activating protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nkap (NFKB activating protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NKAP (NFKB activating protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NKAP (NFKB activating protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nkap (NFKB activating protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NKAP (NFKB activating protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NKAP (NFKB activating protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nkap (NFKB activating protein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NKAPL (NFKB activating protein like) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Nkap (NFKB activating protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NKAP (NFKB activating protein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nkap (NFKB activating protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
let-504
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG6066
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nkap
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 121,238,714 - 121,258,360 (+) NCBI GRCr8 mRatBN7.2 X 116,373,031 - 116,392,677 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 116,372,839 - 116,394,945 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 118,476,600 - 118,496,278 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 122,045,736 - 122,065,413 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 119,591,795 - 119,611,472 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 123,751,196 - 123,770,595 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 123,751,089 - 123,770,595 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 123,887,476 - 123,907,122 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 7,762,215 - 7,781,862 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 115,600,861 - 115,620,299 (+) NCBI Celera Cytogenetic Map X q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nkap Rat (1->4)-beta-D-glucan multiple interactions ISO Nkap (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of NKAP mRNA CTD PMID:36331819 Nkap Rat 1,2-dichloroethane decreases expression ISO Nkap (Mus musculus) 6480464 ethylene dichloride results in decreased expression of NKAP mRNA CTD PMID:28960355 Nkap Rat 1,2-dimethylhydrazine decreases expression ISO Nkap (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NKAP mRNA CTD PMID:22206623 Nkap Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NKAP mRNA CTD PMID:32109520 Nkap Rat 2,3,7,8-Tetrachlorodibenzofuran increases expression EXP 6480464 2 more ... CTD PMID:32109520 Nkap Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of NKAP mRNA CTD PMID:21346803 Nkap Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of NKAP mRNA CTD PMID:21346803 Nkap Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of NKAP mRNA CTD PMID:31881176 Nkap Rat aflatoxin B1 increases expression ISO Nkap (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of NKAP mRNA CTD PMID:19770486 Nkap Rat arsenite(3-) multiple interactions ISO NKAP (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to NKAP mRNA] CTD PMID:32406909 Nkap Rat benzo[a]pyrene affects methylation ISO NKAP (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NKAP exon and Benzo(a)pyrene affects the methylation of NKAP promoter CTD PMID:27901495 Nkap Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NKAP mRNA CTD PMID:25181051 Nkap Rat bisphenol A affects expression ISO NKAP (Homo sapiens) 6480464 bisphenol A affects the expression of NKAP mRNA CTD PMID:30903817 Nkap Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of NKAP gene CTD PMID:28505145 Nkap Rat bisphenol AF decreases expression ISO Nkap (Mus musculus) 6480464 bisphenol AF results in decreased expression of NKAP protein CTD PMID:37216864 Nkap Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of NKAP mRNA CTD PMID:23125180 Nkap Rat copper(II) sulfate decreases expression ISO NKAP (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of NKAP mRNA CTD PMID:19549813 Nkap Rat coumarin affects phosphorylation ISO NKAP (Homo sapiens) 6480464 coumarin affects the phosphorylation of NKAP protein CTD PMID:35688186 Nkap Rat cyclosporin A increases expression ISO NKAP (Homo sapiens) 6480464 Cyclosporine results in increased expression of NKAP mRNA CTD PMID:25562108 and PMID:27989131 Nkap Rat dicrotophos decreases expression ISO NKAP (Homo sapiens) 6480464 dicrotophos results in decreased expression of NKAP mRNA CTD PMID:28302478 Nkap Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency] results in increased expression of NKAP mRNA and Streptozocin promotes the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency] results in increased expression of NKAP mRNA] CTD PMID:30611788 Nkap Rat enzalutamide affects expression ISO NKAP (Homo sapiens) 6480464 enzalutamide affects the expression of NKAP mRNA CTD PMID:30940724 Nkap Rat enzyme inhibitor multiple interactions ISO NKAP (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of NKAP protein CTD PMID:23301498 Nkap Rat furan increases methylation EXP 6480464 furan results in increased methylation of NKAP gene CTD PMID:22079235 Nkap Rat methyl methanesulfonate increases expression ISO NKAP (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of NKAP mRNA CTD PMID:23649840 Nkap Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of NKAP mRNA CTD PMID:33484710 Nkap Rat PCB138 decreases expression EXP 6480464 2 more ... CTD PMID:23829299 Nkap Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Nkap (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of NKAP mRNA CTD PMID:36331819 Nkap Rat sodium arsenite increases expression ISO NKAP (Homo sapiens) 6480464 sodium arsenite results in increased expression of NKAP mRNA CTD PMID:38568856 Nkap Rat streptozocin multiple interactions EXP 6480464 Streptozocin promotes the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency] results in increased expression of NKAP mRNA] CTD PMID:30611788 Nkap Rat titanium dioxide decreases expression ISO Nkap (Mus musculus) 6480464 titanium dioxide results in decreased expression of NKAP mRNA CTD PMID:29264374 Nkap Rat titanium dioxide decreases methylation ISO Nkap (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NKAP gene CTD PMID:35295148 Nkap Rat triphenyl phosphate affects expression ISO NKAP (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NKAP mRNA CTD PMID:37042841 Nkap Rat triptonide decreases expression ISO Nkap (Mus musculus) 6480464 triptonide results in decreased expression of NKAP mRNA CTD PMID:33045310 Nkap Rat valproic acid decreases expression ISO Nkap (Mus musculus) 6480464 Valproic Acid results in decreased expression of NKAP mRNA CTD PMID:21427059 Nkap Rat valproic acid increases expression ISO NKAP (Homo sapiens) 6480464 Valproic Acid results in increased expression of NKAP mRNA CTD PMID:29154799 Nkap Rat valproic acid increases methylation ISO NKAP (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NKAP gene CTD PMID:29154799 Nkap Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of NKAP mRNA CTD PMID:23869203 Nkap Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of NKAP gene CTD PMID:31682807
(1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) acetamide (EXP) aflatoxin B1 (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) chloroprene (EXP) copper(II) sulfate (ISO) coumarin (ISO) cyclosporin A (ISO) dicrotophos (ISO) dioxygen (EXP) enzalutamide (ISO) enzyme inhibitor (ISO) furan (EXP) methyl methanesulfonate (ISO) nitrofen (EXP) PCB138 (EXP) perfluorooctane-1-sulfonic acid (ISO) sodium arsenite (ISO) streptozocin (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
granulocyte differentiation (IEA,ISO) hematopoietic stem cell proliferation (IEA,ISO) hemopoiesis (IEA,ISO) negative regulation of DNA-templated transcription (IBA,ISO,ISS) negative regulation of transcription by RNA polymerase II (IEA,ISO,ISS) Notch signaling pathway (IEA) positive regulation of alpha-beta T cell differentiation (ISO,ISS) somatic stem cell population maintenance (IEA,ISO) T cell differentiation in thymus (IEA,ISO)
Nkap Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 121,238,714 - 121,258,360 (+) NCBI GRCr8 mRatBN7.2 X 116,373,031 - 116,392,677 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 116,372,839 - 116,394,945 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 118,476,600 - 118,496,278 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 122,045,736 - 122,065,413 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 119,591,795 - 119,611,472 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 123,751,196 - 123,770,595 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 123,751,089 - 123,770,595 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 123,887,476 - 123,907,122 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 7,762,215 - 7,781,862 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 115,600,861 - 115,620,299 (+) NCBI Celera Cytogenetic Map X q35 NCBI
NKAP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 119,920,672 - 119,943,751 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 119,920,672 - 119,943,751 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 119,054,635 - 119,077,714 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 118,943,051 - 118,961,763 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera X 119,513,642 - 119,532,364 (-) NCBI Celera Cytogenetic Map X q24 NCBI HuRef X 108,555,462 - 108,574,439 (-) NCBI HuRef CHM1_1 X 118,970,042 - 118,988,764 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 118,295,798 - 118,318,877 (-) NCBI T2T-CHM13v2.0
Nkap Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 36,390,416 - 36,414,399 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 36,390,448 - 36,414,399 (+) Ensembl GRCm39 Ensembl GRCm38 X 37,126,763 - 37,150,746 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 37,126,795 - 37,150,746 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 34,666,758 - 34,690,741 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 33,558,261 - 33,582,191 (+) NCBI MGSCv36 mm8 Celera X 23,850,391 - 23,874,368 (+) NCBI Celera Cytogenetic Map X A3.3 NCBI cM Map X 21.54 NCBI
Nkap Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955534 106,122 - 119,344 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955534 106,122 - 119,508 (+) NCBI ChiLan1.0 ChiLan1.0
NKAP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 119,332,833 - 119,351,220 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 119,336,438 - 119,354,814 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 108,988,561 - 109,006,946 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 119,384,489 - 119,402,943 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 119,384,655 - 119,402,775 (-) Ensembl panpan1.1 panPan2
NKAP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 91,922,326 - 91,956,566 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 91,923,550 - 91,956,414 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 77,994,979 - 78,030,230 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 93,659,144 - 93,694,394 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 93,660,195 - 93,694,327 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 91,112,068 - 91,147,313 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 92,871,557 - 92,906,785 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 92,600,530 - 92,635,783 (-) NCBI UU_Cfam_GSD_1.0
Nkap Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 90,945,876 - 90,962,816 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936479 10,024,705 - 10,041,590 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936479 10,024,674 - 10,041,738 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NKAP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 98,256,632 - 98,276,773 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 98,233,504 - 98,276,839 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 113,335,166 - 113,355,494 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NKAP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Vero_WHO_p1.0 NW_023666065 32,710,929 - 32,731,311 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nkap
.
Predicted Target Of
Count of predictions: 22 Count of miRNA genes: 22 Interacting mature miRNAs: 22 Transcripts: ENSRNOT00000047912 Prediction methods: Miranda, Pita, Rnahybrid Result types: miRGate_prediction
1598872 Memor14 Memory QTL 14 4.5 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 93956491 138956491 Rat 1598856 Memor1 Memory QTL 1 1.9 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) X 103312877 148312877 Rat 1598809 Memor15 Memory QTL 15 4.4 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 103312877 148312877 Rat 738025 Stresp3 Stress response QTL 3 4.61 0.0066 stress-related behavior trait (VT:0010451) defensive burying - approach X 100567703 150256146 Rat 61430 Cia18 Collagen induced arthritis QTL 18 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 14843113 120568734 Rat 738029 Stresp2 Stress response QTL 2 3.4 0.0004 stress-related behavior trait (VT:0010451) defensive burying - approach X 112934952 138400867 Rat 61431 Cia19 Collagen induced arthritis QTL 19 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) X 65612192 120568734 Rat 5685004 Bss104 Bone structure and strength QTL 104 3.9 tibia area (VT:1000281) tibia area measurement (CMO:0001382) X 113805422 126975220 Rat 10059603 Bw174 Body weight QTL 174 3.4 0.025 body mass (VT:0001259) body weight (CMO:0000012) X 113937816 152453651 Rat 724551 Glom1 Glomerulus QTL 1 2.8 0.0004 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) X 75294106 120294106 Rat 1598837 Memor13 Memory QTL 13 3.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 41052407 146860749 Rat
D20S1001
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 116,392,481 - 116,392,581 (+) MAPPER mRatBN7.2 Rnor_6.0 X 123,770,400 - 123,770,499 NCBI Rnor6.0 Rnor_5.0 X 123,906,927 - 123,907,026 UniSTS Rnor5.0 RGSC_v3.4 X 7,762,311 - 7,762,410 UniSTS RGSC3.4 Celera X 115,620,104 - 115,620,203 UniSTS Cytogenetic Map X q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000089883 ⟹ ENSRNOP00000073123
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 116,372,839 - 116,394,945 (+) Ensembl Rnor_6.0 Ensembl X 123,751,293 - 123,770,511 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092384 ⟹ ENSRNOP00000075780
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 116,372,929 - 116,380,390 (+) Ensembl Rnor_6.0 Ensembl X 123,751,089 - 123,765,639 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092554 ⟹ ENSRNOP00000075909
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl X 123,770,337 - 123,770,595 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000092564
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl X 123,751,496 - 123,760,081 (+) Ensembl
RefSeq Acc Id:
NM_001024872 ⟹ NP_001020043
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 121,238,714 - 121,258,360 (+) NCBI mRatBN7.2 X 116,373,031 - 116,392,677 (+) NCBI Rnor_6.0 X 123,751,196 - 123,770,595 (+) NCBI Rnor_5.0 X 123,887,476 - 123,907,122 (+) NCBI RGSC_v3.4 X 7,762,215 - 7,781,862 (-) RGD Celera X 115,600,861 - 115,620,299 (+) RGD
Sequence:
CGCTGCAAGCTCTAAGACCCTAGGTATCCGAGAACCTTTAGGGGACAAGGAGAGCGCCTCCTTGTCCCGCCCCTTAGCCGGTTCAGCTCACACCACCATGGCTCCTGTGTCGGGCTCGCGTAGCCCTG
hide sequence
RefSeq Acc Id:
NP_001020043 ⟸ NM_001024872
- UniProtKB:
Q4V7C9 (UniProtKB/Swiss-Prot), A6JMH7 (UniProtKB/TrEMBL)
- Sequence:
MAPVSGSRSPVREASGGKRRSSSRSPKSIKSSRSPRCRRSRSRSCSRFGDRNGLSHSLSGFSQSSRNQSYRSRSRSRSRERPSAQRSAPFASSSSSAYYGGYSRPYGGDKPWPSLLDKEREESLRQKR
hide sequence
Ensembl Acc Id:
ENSRNOP00000075780 ⟸ ENSRNOT00000092384
Ensembl Acc Id:
ENSRNOP00000075909 ⟸ ENSRNOT00000092554
Ensembl Acc Id:
ENSRNOP00000073123 ⟸ ENSRNOT00000089883
RGD ID: 13701988 Promoter ID: EPDNEW_R12512 Type: initiation region Name: Nkap_1 Description: NFKB activating protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R12513 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 123,751,119 - 123,751,179 EPDNEW
RGD ID: 13701994 Promoter ID: EPDNEW_R12513 Type: single initiation site Name: Nkap_2 Description: NFKB activating protein SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R12512 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 123,751,285 - 123,751,345 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-26
Nkap
NFKB activating protein
2610020o08rik
nuclear NF-kappaB activating protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
2610020o08rik
nuclear NF-kappaB activating protein
Symbol and Name status set to provisional
70820 PROVISIONAL
