Advanced Search (OLGA)

Gene: Jagn1 (jagunal vesicle mediated transporter 1) Rattus norvegicus

Analyze

Symbol:

Jagn1

Name:

jagunal vesicle mediated transporter 1 (Ensembl:jagunal homolog 1)

RGD ID:

1565488

Description:

Involved in negative regulation of insulin secretion involved in cellular response to glucose stimulus. Predicted to be located in endoplasmic reticulum. Predicted to be active in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in severe congenital neutropenia 6. Orthologous to human JAGN1 (jagunal homolog 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

jagunal homolog 1; jagunal homolog 1 (Drosophila); LOC502872; MGC112769; protein jagunal homolog 1; similar to RIKEN cDNA 5830427H10

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	JAGN1 (jagunal vesicle mediated transporter 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Jagn1 (jagunal homolog 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Jagn1 (jagunal vesicle mediated transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	JAGN1 (jagunal vesicle mediated transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	JAGN1 (jagunal homolog 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Jagn1 (jagunal vesicle mediated transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	JAGN1 (jagunal vesicle mediated transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	JAGN1 (jagunal vesicle mediated transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Jagn1 (jagunal vesicle mediated transporter 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ADGRG5 (adhesion G protein-coupled receptor G5)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	JAGN1 (jagunal vesicle mediated transporter 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Jagn1 (jagunal homolog 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	jagn1a (jagunal homolog 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	jagn1b (jagunal homolog 1b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	jagn1b (jagunal homolog 1b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	K05C4.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	jagn	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	jagn	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	jagn1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	148,147,213 - 148,151,915 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	148,147,229 - 148,151,915 (+)	Ensembl				GRCr8
mRatBN7.2	4	146,591,577 - 146,596,287 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	146,591,510 - 146,596,288 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	151,975,486 - 151,980,159 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	147,756,333 - 147,761,006 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	146,377,916 - 146,382,566 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	145,399,885 - 145,404,605 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	145,399,913 - 145,404,617 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	208,697,287 - 208,701,991 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	4	135,147,688 - 135,152,362 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

neutropenia (ISO)

severe congenital neutropenia (ISO)

severe congenital neutropenia 6 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-alpha-phellandrene (ISO)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

alpha-phellandrene (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dibenzo[a,l]pyrene (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

diquat (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

iron dichloride (ISO)

ivermectin (ISO)

kainic acid (ISO)

leflunomide (EXP,ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methimazole (EXP)

mono(2-ethylhexyl) phthalate (ISO)

nefazodone (EXP)

nicotine (ISO)

nimesulide (EXP)

pirinixic acid (ISO)

propiconazole (ISO)

rac-lactic acid (ISO)

rotenone (EXP)

silicon dioxide (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tamoxifen (ISO)

thiram (ISO)

titanium dioxide (ISO)

tolcapone (EXP)

tunicamycin (EXP,ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

defense response to fungus (IEA,ISO,ISS)

endoplasmic reticulum organization (IBA,IEA)

granulocyte colony-stimulating factor signaling pathway (IBA,IEA,ISO,ISS)

immune system process (IEA)

insulin metabolic process (ISO)

insulin secretion (ISO)

negative regulation of insulin secretion involved in cellular response to glucose stimulus (IMP)

neutrophil differentiation (ISO,ISS)

neutrophil mediated immunity (IEA,ISO,ISS)

neutrophil migration (IEA,ISO,ISS)

protein transport (IEA)

response to endoplasmic reticulum stress (ISO)

response to glucose (ISO)

vesicle-mediated transport (IBA,IEA,ISO,ISS)

Cellular Component

endoplasmic reticulum (IEA,ISO,ISS)

endoplasmic reticulum membrane (IBA,IEA)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	JAGN1 Deficient Severe Congenital Neutropenia: Two Cases from the Same Family.	Baris S, etal., J Clin Immunol. 2015 May;35(4):339-43. doi: 10.1007/s10875-015-0156-2. Epub 2015 Apr 8.
2.	JAGN1 deficiency causes aberrant myeloid cell homeostasis and congenital neutropenia.	Boztug K, etal., Nat Genet. 2014 Sep;46(9):1021-7. doi: 10.1038/ng.3069. Epub 2014 Aug 17.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Jagn1 Is Induced in Response to ER Stress and Regulates Proinsulin Biosynthesis.	Nosak C, etal., PLoS One. 2016 Feb 16;11(2):e0149177. doi: 10.1371/journal.pone.0149177. eCollection 2016.
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:25129145

Genomics

Comparative Map Data

Jagn1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	148,147,213 - 148,151,915 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	148,147,229 - 148,151,915 (+)	Ensembl				GRCr8
mRatBN7.2	4	146,591,577 - 146,596,287 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	146,591,510 - 146,596,288 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	151,975,486 - 151,980,159 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	147,756,333 - 147,761,006 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	146,377,916 - 146,382,566 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	145,399,885 - 145,404,605 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	145,399,913 - 145,404,617 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	208,697,287 - 208,701,991 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
Celera	4	135,147,688 - 135,152,362 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JAGN1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	9,890,610 - 9,894,349 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	9,890,574 - 9,894,349 (+)	Ensembl			hg38	GRCh38
GRCh37	3	9,932,294 - 9,936,033 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	9,907,272 - 9,911,029 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	9,907,271 - 9,911,029	NCBI
Celera	3	9,867,730 - 9,871,500 (+)	NCBI		Celera
Cytogenetic Map	3	p25.3	NCBI
HuRef	3	9,868,607 - 9,872,377 (+)	NCBI		HuRef
CHM1_1	3	9,882,427 - 9,886,189 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	9,882,615 - 9,886,362 (+)	NCBI		T2T-CHM13v2.0

Jagn1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	113,419,478 - 113,425,190 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	113,419,530 - 113,425,190 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	113,442,517 - 113,448,229 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	113,442,569 - 113,448,229 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	113,392,629 - 113,398,221 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	113,408,412 - 113,414,004 (+)	NCBI		MGSCv36	mm8
Celera	6	115,269,598 - 115,275,190 (+)	NCBI		Celera
Cytogenetic Map	6	E3	NCBI
cM Map	6	52.76	NCBI

Jagn1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955561	1,388,592 - 1,392,107 (+)	Ensembl
ChiLan1.0	NW_004955561	1,388,592 - 1,392,107 (+)	NCBI	ChiLan1.0	ChiLan1.0

JAGN1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	9,894,619 - 9,897,922 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	9,899,397 - 9,902,681 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	9,835,123 - 9,838,398 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	10,183,760 - 10,187,064 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	10,183,760 - 10,187,064 (+)	Ensembl			panPan2	panpan1.1

JAGN1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	8,372,981 - 8,376,089 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	8,373,316 - 8,376,085 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	8,406,663 - 8,409,852 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	8,402,220 - 8,405,411 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	8,402,229 - 8,405,333 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	8,124,553 - 8,127,743 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	8,470,019 - 8,473,199 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	8,443,116 - 8,446,297 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Jagn1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	15,606,195 - 15,609,027 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936602	3,298,348 - 3,303,555 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936602	3,300,685 - 3,303,509 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

JAGN1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	13	66,154,855 - 66,158,329 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	73,229,981 - 73,254,079 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

JAGN1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	45,917,319 - 45,921,082 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	45,917,444 - 45,920,250 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	120,642,931 - 120,646,710 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Jagn1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	33,087,433 - 33,091,953 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Jagn1
25 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	70
Count of miRNA genes:	56
Interacting mature miRNAs:	66
Transcripts:	ENSRNOT00000012177
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	86583980	149763391	Rat
1300116	Hrtrt5	Heart rate QTL 5	3.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	117737142	152833657	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	146370897	184426481	Rat
1358364	Sradr4	Stress Responsive Adrenal Weight QTL 4	4.92		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	131384565	176384565	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	123870974	168870974	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	140059299	181024663	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
731165	Uae21	Urinary albumin excretion QTL 21	2.4	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	4	108206096	153206096	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	106848959	168870974	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	127263297	172263297	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	147299608	184426481	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
1549832	Bss3	Bone structure and strength QTL 3	11		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	4	111383604	156383604	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82944895	154403548	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	137430611	182430611	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	103834277	148834277	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	146370897	184426481	Rat
2302049	Pia32	Pristane induced arthritis QTL 32	5.1	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	107346299	152346299	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	134095016	179095016	Rat
6478763	Anxrr46	Anxiety related response QTL 46		0.07428	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	112427331	157427331	Rat
6478760	Anxrr45	Anxiety related response QTL 45		0.06717	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	112427331	157427331	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	117559384	162559384	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
7207480	Bss105	Bone structure and strength QTL 105	8.1		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	4	111383604	156383604	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	126334185	171334185	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	124700988	169700988	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
1581566	Eae21	Experimental allergic encephalomyelitis QTL 21	6.2		body mass (VT:0001259)	maximum body weight loss to initial body weight ratio (CMO:0001400)	4	137447185	182447185	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	134199006	168870974	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	148121375	176967367	Rat
2293840	Kiddil9	Kidney dilation QTL 9	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	4	113634167	149763391	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	116184844	161184844	Rat
12798527	Anxrr58	Anxiety related response QTL 58	4.11	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	121020385	148834277	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat

Markers in Region

RH129589

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	146,596,070 - 146,596,250 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	145,404,389 - 145,404,568	NCBI	Rnor6.0
Rnor_5.0	4	208,701,775 - 208,701,954	UniSTS	Rnor5.0
Celera	4	135,152,146 - 135,152,325	UniSTS
RH 3.4 Map	4	934.1	UniSTS
Cytogenetic Map	4	q42	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001044272	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006237053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063286616	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC183952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098749	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012177 ⟹ ENSRNOP00000053385

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	148,147,229 - 148,151,915 (+)	Ensembl
mRatBN7.2 Ensembl	4	146,591,510 - 146,596,288 (+)	Ensembl
Rnor_6.0 Ensembl	4	145,399,913 - 145,404,617 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102869 ⟹ ENSRNOP00000084096

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	146,591,624 - 146,596,116 (+)	Ensembl

RefSeq Acc Id:

NM_001044272 ⟹ NP_001037737

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,147,239 - 148,151,914 (+)	NCBI
mRatBN7.2	4	146,591,608 - 146,596,287 (+)	NCBI
Rnor_6.0	4	145,399,930 - 145,404,605 (+)	NCBI
Rnor_5.0	4	208,697,287 - 208,701,991 (+)	NCBI
Celera	4	135,147,688 - 135,152,362 (+)	RGD

Sequence:

show sequence

GTGGAAGCGGAGAGGAGGAGGCAGGAAAGCGGTTCTCTGGGAGCCTGGCTAGGTGTGAGCCAGA
GGGTCGGCGTTAGGGCCTTAGGTTCTTCACGATGGCGTCTCGGGCAGGCCCACGAGCGGCCGGC
ACCGACGGCAGCGACTTTCAGCACCGGGAACGAGTCGCCATGCACTACCAAATGAGTGTGACCC
TCAAGTACGAAATCAAGAAGCTGATCTACGTGCATCTCGTCATATGGCTGCTGTTGGTTGCCAA
GATGAGTGTGGGACACCTGAGGCTCTTGTCACATGACCAGGTGGCCATGCCCTATCAGTGGGAA
TATCCGTATTTGTTGAGCATTGTGCCCTCTGTCTTGGGTCTTCTCTCCTTCCCTCGAAACAACA
TTAGCTACCTGGTGCTCTCTATGATCAGCATGGGGCTCTTCTCCATCGCTCCCCTCATTTATGG
CAGCATGGAGATGTTCCCTGCGGCACAGCAGCTCTACCGCCATGGCAAGGCCTATCGCTTCCTG
TTCGGTTTTTCCGCCGTCTCTGTCATGTACCTGGTGTTGGTACTGGCAGTCCAAGTTCATGCCT
GGCAACTCTACTACAGCAAGAAACTCCTAGACTCTTGGTTCACCAGCACACAGGAGAAGAAACG
TAAATGATGAAGCCTGCTTGATGAACTGCTATGGGGGTAGAACCTAGGGCTCCCACTGAGCAGG
TGGAGGGGGCTGTTCAGAATCTCCACAGACTGGCATCTGTGATGTTGACACCCAGTGCACTCTA
GGCTCAAAGCTTGGCCTAGAGTTCTCTCTCACCATCTGCTGAGGCGGCAAAGCTGTAGTATTTA
ATTTATTCTTGACTAGCTACAGCGGGGTAACCAGTGGCTGTGAAACGCTTTAACTGGTTGAACT
TGAGGCCCTCTAGAGTTTGGGTTTTGCAGACTGAGCCTTACCTTGCCTTCTCTTGGTCATACTC
CCTACTTCCGTGCATCACCTCCTCACCACCAATTACAAAAAGAAATCTGGAATAATCCATATGT
CAAGTGGACTTCAACCCGTAGGTCACAGGGCAGGCAACATTTGGGAAGCTGCTCCCCTACAGGC
TGTTCTGTTTACTGCAAACCATTTTAAATCAAGAACCTCAATAAAGTTAAGACTGTCCTGTAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006237053 ⟹ XP_006237115

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,147,213 - 148,151,057 (+)	NCBI
mRatBN7.2	4	146,591,577 - 146,595,430 (+)	NCBI
Rnor_6.0	4	145,399,885 - 145,403,748 (+)	NCBI
Rnor_5.0	4	208,697,287 - 208,701,991 (+)	NCBI

Sequence:

show sequence

AGGGCTAGAGAGACCGGAAGTGCTCCCAGAGCTGCAGGCCGTGTGGTGGAAGCGGAGAGGAGGA
GGCAGGAAAGCGGTTCTCTGGGAGCCTGGCTAGGTGTGAGCCAGAGGGTCGGCGTTAGGGCCTT
AGGTTCTTCACGATGGCGTCTCGGGCAGGCCCACGAGCGGCCGGCACCGACGGCAGCGACTTTC
AGCACCGGGAACGAGTCGCCATGCACTACCAAATGAGGTACGAGTGTGACCCTCAAGTACGAAA
TCAAGAAGCTGATCTACGTGCATCTCGTCATATGGCTGCTGTTGGTTGCCAAGATGAGTGTGGG
ACACCTGAGGCTCTTGTCACATGA

hide sequence

RefSeq Acc Id:

XM_063286616 ⟹ XP_063142686

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	148,147,285 - 148,151,915 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001037737	(Get FASTA)	NCBI Sequence Viewer
	XP_006237115	(Get FASTA)	NCBI Sequence Viewer
	XP_063142686	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98749	(Get FASTA)	NCBI Sequence Viewer
	EDL91538	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000053385
	ENSRNOP00000053385.2
GenBank Protein	Q4KM64	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001037737 ⟸ NM_001044272
- UniProtKB:	Q4KM64 (UniProtKB/Swiss-Prot), A6IBS0 (UniProtKB/TrEMBL), A0A8I5ZXA3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MASRAGPRAAGTDGSDFQHRERVAMHYQMSVTLKYEIKKLIYVHLVIWLLLVAKMSVGHLRLLS HDQVAMPYQWEYPYLLSIVPSVLGLLSFPRNNISYLVLSMISMGLFSIAPLIYGSMEMFPAAQQ LYRHGKAYRFLFGFSAVSVMYLVLVLAVQVHAWQLYYSKKLLDSWFTSTQEKKRK hide sequence

RefSeq Acc Id:	XP_006237115 ⟸ XM_006237053
- Peptide Label:	isoform X2
- Sequence:	show sequence MASRAGPRAAGTDGSDFQHRERVAMHYQMRYECDPQVRNQEADLRASRHMAAVGCQDECGTPEA LVT hide sequence

Ensembl Acc Id:

ENSRNOP00000053385 ⟸ ENSRNOT00000012177

Ensembl Acc Id:

ENSRNOP00000084096 ⟸ ENSRNOT00000102869

RefSeq Acc Id:	XP_063142686 ⟸ XM_063286616
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4KM64-F1-model_v2	AlphaFold	Q4KM64	1-183	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693303

Promoter ID:

EPDNEW_R3827

Type:

initiation region

Name:

Jagn1_1

Description:

jagunal homolog 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	145,399,920 - 145,399,980	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565488	AgrOrtholog
BioCyc Gene	G2FUF-43381	BioCyc
Ensembl Genes	ENSRNOG00000009175	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000012177	ENTREZGENE
	ENSRNOT00000012177.6	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7365215	IMAGE-MGC_LOAD
InterPro	Jagunal	UniProtKB/Swiss-Prot
KEGG Report	rno:502872	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:112769	IMAGE-MGC_LOAD
NCBI Gene	502872	ENTREZGENE
PANTHER	PROTEIN JAGUNAL HOMOLOG 1	UniProtKB/Swiss-Prot
	PTHR20955	UniProtKB/Swiss-Prot
Pfam	Jagunal	UniProtKB/Swiss-Prot
PhenoGen	Jagn1	PhenoGen
RatGTEx	ENSRNOG00000009175	RatGTEx
UniProt	A0A8I5ZXA3	ENTREZGENE
	A6IBS0	ENTREZGENE, UniProtKB/TrEMBL
	JAGN1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2025-11-13	Jagn1	jagunal vesicle mediated transporter 1	Jagn1	jagunal homolog 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-06-17	Jagn1	jagunal homolog 1	Jagn1	jagunal homolog 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Jagn1	jagunal homolog 1 (Drosophila)	LOC502872	similar to RIKEN cDNA 5830427H10	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC502872	similar to RIKEN cDNA 5830427H10			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM