Advanced Search (OLGA)

Gene: Trmt13 (tRNA methyltransferase 13) Rattus norvegicus

Analyze

Symbol:

Trmt13

Name:

tRNA methyltransferase 13 (Ensembl:tRNA methyltransferase 13 homolog)

RGD ID:

1565211

Description:

Predicted to enable tRNA methyltransferase activity. Predicted to be involved in tRNA methylation. Orthologous to human TRMT13 (tRNA methyltransferase 13 homolog); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Ccdc76; coiled-coil domain containing 76; MGC124992; similar to hypothetical protein FLJ10287; tRNA guanosine-2'-O-methyltransferase TRM13 homolog; tRNA methyltransferase 13 homolog; tRNA methyltransferase 13 homolog (S. cerevisiae); tRNA:m(4)X modification enzyme TRM13 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TRMT13 (tRNA methyltransferase 13)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Trmt13 (tRNA methyltransferase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Trmt13 (tRNA methyltransferase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TRMT13 (tRNA methyltransferase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TRMT13 (tRNA methyltransferase 13 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Trmt13 (tRNA methyltransferase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TRMT13 (tRNA methyltransferase 13 homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TRMT13 (tRNA methyltransferase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Trmt13 (tRNA methyltransferase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Trmt13 (tRNA methyltransferase 13)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TRMT13 (tRNA methyltransferase 13)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Trmt13 (tRNA methyltransferase 13)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	trmt13 (tRNA methyltransferase 13 homolog)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG18048	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TRM13	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y49A3A.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	trmt13	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	207,217,399 - 207,232,467 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	207,218,552 - 207,231,701 (-)	Ensembl				GRCr8
mRatBN7.2	2	204,533,630 - 204,547,711 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	204,533,632 - 204,546,843 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	212,190,857 - 212,203,797 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	210,099,823 - 210,112,980 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	204,916,896 - 204,930,053 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	219,615,665 - 219,628,824 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	219,615,420 - 219,628,997 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	237,588,550 - 237,601,709 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	212,812,720 - 212,825,603 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	197,025,611 - 197,038,612 (-)	NCBI		Celera
Cytogenetic Map	2	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-palmitoylglycerol (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

cyclosporin A (ISO)

deoxynivalenol (ISO)

dioxygen (ISO)

fluoranthene (ISO)

folic acid (ISO)

fulvestrant (ISO)

gold atom (ISO)

gold(0) (ISO)

GSK-J4 (ISO)

haloperidol (ISO)

irinotecan (ISO)

levonorgestrel (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

sulfadimethoxine (EXP)

sulforaphane (ISO)

sunitinib (ISO)

testosterone undecanoate (ISO)

tetrachloromethane (EXP)

theophylline (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

methylation (IEA)

tRNA methylation (IBA,IEA)

tRNA processing (IEA)

Molecular Function

metal ion binding (IEA)

methyltransferase activity (IEA)

transferase activity (IEA)

tRNA 2'-O-methyltransferase activity (IEA)

tRNA methyltransferase activity (IBA)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Genomics

Comparative Map Data

Trmt13
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	207,217,399 - 207,232,467 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	207,218,552 - 207,231,701 (-)	Ensembl				GRCr8
mRatBN7.2	2	204,533,630 - 204,547,711 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	204,533,632 - 204,546,843 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	212,190,857 - 212,203,797 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	210,099,823 - 210,112,980 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	204,916,896 - 204,930,053 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	219,615,665 - 219,628,824 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	219,615,420 - 219,628,997 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	237,588,550 - 237,601,709 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	212,812,720 - 212,825,603 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	197,025,611 - 197,038,612 (-)	NCBI		Celera
Cytogenetic Map	2	q42	NCBI

TRMT13
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	100,133,163 - 100,150,496 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	100,133,045 - 100,150,496 (+)	Ensembl			hg38	GRCh38
GRCh37	1	100,598,719 - 100,616,052 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	100,371,307 - 100,388,641 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	1	98,855,584 - 98,872,932 (+)	NCBI		Celera
Cytogenetic Map	1	p21.2	NCBI
HuRef	1	98,721,459 - 98,738,807 (+)	NCBI		HuRef
CHM1_1	1	100,715,060 - 100,732,408 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	99,981,278 - 99,998,611 (+)	NCBI		T2T-CHM13v2.0

Trmt13
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	116,365,706 - 116,408,236 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	116,374,742 - 116,408,236 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	116,576,061 - 116,614,587 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	116,581,093 - 116,614,587 (-)	Ensembl			mm10	GRCm38
MGSCv37	3	116,284,254 - 116,317,505 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	116,284,254 - 116,317,505 (-)	NCBI		MGSCv36	mm8
Celera	3	123,008,443 - 123,041,411 (-)	NCBI		Celera
Cytogenetic Map	3	G1	NCBI
cM Map	3	50.4	NCBI

Trmt13
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955435	4,885,925 - 4,900,962 (+)	Ensembl
ChiLan1.0	NW_004955435	4,885,910 - 4,902,759 (+)	NCBI	ChiLan1.0	ChiLan1.0

TRMT13
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	126,873,956 - 126,894,776 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	126,035,464 - 126,052,891 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	102,790,960 - 102,808,365 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	101,506,349 - 101,523,722 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	101,506,349 - 101,523,722 (+)	Ensembl			panPan2	panpan1.1

TRMT13
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	49,836,551 - 49,859,458 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	49,839,047 - 49,859,316 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	52,506,225 - 52,529,170 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	50,182,905 - 50,205,858 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	50,186,900 - 50,209,389 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	49,874,595 - 49,897,537 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	49,853,596 - 49,876,538 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	50,285,279 - 50,308,226 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Trmt13
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	110,484,766 - 110,507,991 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936748	289,684 - 313,155 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936748	290,033 - 312,097 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TRMT13
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	117,961,116 - 117,985,620 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	117,961,114 - 117,985,633 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	129,579,066 - 129,583,763 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TRMT13
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	33,188,060 - 33,205,434 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	33,189,742 - 33,205,388 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	24,852,141 - 24,869,433 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Trmt13
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624857	2,930,691 - 2,948,311 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624857	2,930,504 - 2,950,288 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Trmt13
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	43,126,038 - 43,139,040 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Trmt13
103 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	206
Count of miRNA genes:	135
Interacting mature miRNAs:	148
Transcripts:	ENSRNOT00000064484
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	163997722	225110681	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	169358774	214358774	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170656145	239614549	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	149957381	221199885	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	204795005	249795005	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
61458	Bp10	Blood pressure QTL 10	3.42		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
1581578	Cm49	Cardiac mass QTL 49	4.9	0.01	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	145807215	220931416	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	124537199	209621565	Rat
1302789	Stl26	Serum triglyceride level QTL 26	3.1	0.0035	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	206613059	226891081	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	196140964	251540988	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	205135267	250135267	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	170652929	215652929	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	159440891	220931218	Rat
1581499	Esta2	Estrogen-induced thymic atrophy QTL 2			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	192287802	229609668	Rat
1359031	Bp275	Blood pressure QTL 275			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	188565047	233565047	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	184856304	229856304	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	184856304	229856304	Rat
1298083	Bp158	Blood pressure QTL 158	2.62		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	191709311	217961898	Rat
1357991	Ael2	Aortic elastin QTL 2	4.2	0.000071	aorta elastin amount (VT:0003905)	aortic elastin	2	169227906	214227906	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1331745	Bp203	Blood pressure QTL 203	4.377		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	192287802	221089121	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	192287802	237287802	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	184856304	229856304	Rat
1578671	Bmd10	Bone mineral density QTL 10	5.4		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	2	175931416	220931416	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	251712708	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
2300189	Bmd48	Bone mineral density QTL 48	5.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	182024327	227024327	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	159440760	228950743	Rat
2301408	Kidm36	Kidney mass QTL 36		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	184482291	229482291	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	205135267	250135267	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	202029709	236904960	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	205135267	225627153	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	145306936	212705578	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	186850607	231850607	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	192287802	237287802	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	151869660	223841096	Rat
61417	Cia10	Collagen induced arthritis QTL 10	3.4		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	2	182635347	227635347	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	175008837	220008837	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	203664411	248664411	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	184856304	229856304	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	165453811	210453811	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	163253030	208253030	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166372086	229820014	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001033902	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102944	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282407	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010063655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010063656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC103656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC166503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229185	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000064484 ⟹ ENSRNOP00000062314

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	207,218,552 - 207,231,701 (-)	Ensembl
mRatBN7.2 Ensembl	2	204,533,632 - 204,546,843 (-)	Ensembl
Rnor_6.0 Ensembl	2	219,615,420 - 219,628,997 (-)	Ensembl

RefSeq Acc Id:

NM_001033902 ⟹ NP_001029074

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,218,542 - 207,231,701 (-)	NCBI
mRatBN7.2	2	204,533,630 - 204,546,789 (-)	NCBI
Rnor_6.0	2	219,615,665 - 219,628,824 (-)	NCBI
Rnor_5.0	2	237,588,550 - 237,601,709 (+)	NCBI
RGSC_v3.4	2	212,812,720 - 212,825,603 (-)	RGD
Celera	2	197,025,611 - 197,038,612 (-)	RGD

Sequence:

show sequence

GCCAGGCCAAAAGGACCCAGCGTGATGGAGGCTCCTGCTCCGACAACGCCCGCGATCGGTTTTC
CAACTGACGGTAGATGCAACTACTTTGTGGAAAAGAAGAAGCGCTTCTGCAGGATGGTGGTGGC
CGCGGGGAAAAGGTTCTGTGGTGAACACGCTGGATCGGCGGAGGAAGAAAATGCTCGGAAAAGA
ATCTTATGTCCTTTAGATCCAAAACACACAGTATATGAAGACCAACTAGCAAAACATTTGAAAA
AATGTAATTCAAGAGAGAAGCCTAAGCCTGATTTCTTTATTCAAGATATAAATGCAGGATTAAA
GGATGAAACAGAAATTCTTGAACAATTAGTTCCACTTTCTTCTCTATCTGAGGAGCAGTTGGAA
ACCTTAATTAAGAAATTGAGAAAAGCAAGTGAAGGCTTGAACTCTACACATGAAGATCACATTA
TGTCCCATCCAGCATTACACGACGCCCTTAATGACCCGAGAAATGGTGATTGTGCAGTCAAGCA
CCTGAAACAGCAGGCTTCTATTTTAGGTAACATTGAAAAATTAAAGTTACTTGGTCCAAGAAGA
TGCTTTGTTGAGTTTGGAGCAGGAAAGGGGAAATTATCTCACTGGGTTGATATTGCCTTAAAAG
ATGCTGAAAACGTTCACTTCATCCTGGTAGAAAAAGTGACCACAAGATTCAAGGTAGATGGTAA
ACACAGAAAAAAGAACTCAGTGTTTGAAAGACTTCAAATTGATATCCAACACTTGTGCTTGAAC
AGGCTTCCTGTGCTAAGAGAAGGAAGACTGCCTGTAGTAGGAATTGGGAAGCACCTGTGTGGGG
TGGCAACAGATCTTGCATTACGATGTTTGGTTGAAACCTATGCTGCCAGTTTTAAGGAAAAGGA
TGAAGAACCTTTAGCCAAACGCGTAAAGAATGATAAAACAGAAAAAGAAAGTAACACTTTGGCC
AAGGAAGGAAGTGAAAAAGATGTCCCAGAGACACGGACCCCTGTGGCTGGCATTGTCATTGCGC
TCTGTTGTCACCACAGGTGTGACTGGAGACATTATGTGGGCAAAGAGTATTTCAAGGCTCTTGG
GCTTGGCGCAGTGGAGTTCTACTATTTCCAGAGAATGAGTAGTTGGGCAACGTGTGGGATGAGG
ACGTCTTTGGAAGCCTCAGATGTTACTGCAGAGAGAAAAGATGCTCAGAAGGATGAGGAGGAAG
AGCACGATGATGTAGGAGACAGACTCACGGATGGCAGCACTGACAGTTTGCCTGGGACTCTTAC
TGTTGAAGAAAAGAAGAAAATAGGACATCTTTGCAAATTGCTGATTGACCAAGGCCGACTCCAG
TATTTACAGCAGAAAGGCTTCAGTCCTGCCTTACAGTACTATACGGACCCATTGGTGTCTCTGG
AAAATGTATTATTAACTGCTGTACCGGCTCATCTGTCATCGCAGGAAAAAAATCAATCAGTGAA
AGGAAACATGAACATGATGTCTTCCACAAGCAAAAAATAAATAAATTATTTTTAAATTATATTT
TGATAGTCACAAAAATATTCACCCAGTTGTCGAAGTATTCCTTTTCAGCGGGACTCTTTAAATT
ACTTTATCCATCAGACCGTGTAGAGCTGGGCGTATGAGTCAGACAGTTGACTTGGTCTTCTGAA
AGATAGAACATCAGCATATAATTACAGTACGAACTCCGTGTCTTAATCTGGTAAACTTGTCTTT
GGTTTTATCTGATAAGTTTTCATTTTTTTGAGCTCCAGCTGTAATAAACAGTAGAAGTTTATAA
CAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039102944 ⟹ XP_038958872

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,217,399 - 207,231,677 (-)	NCBI
mRatBN7.2	2	204,533,877 - 204,546,844 (-)	NCBI

RefSeq Acc Id:

XM_039102947 ⟹ XP_038958875

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,217,399 - 207,231,769 (-)	NCBI
mRatBN7.2	2	204,533,630 - 204,546,630 (-)	NCBI

RefSeq Acc Id:

XM_039102948 ⟹ XP_038958876

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,217,399 - 207,232,467 (-)	NCBI
mRatBN7.2	2	204,533,630 - 204,547,711 (-)	NCBI

RefSeq Acc Id:

XM_039102949 ⟹ XP_038958877

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,217,399 - 207,232,098 (-)	NCBI
mRatBN7.2	2	204,533,630 - 204,547,177 (-)	NCBI

RefSeq Acc Id:

XM_039102950 ⟹ XP_038958878

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,217,399 - 207,231,769 (-)	NCBI
mRatBN7.2	2	204,533,877 - 204,546,630 (-)	NCBI

RefSeq Acc Id:

XM_039102953 ⟹ XP_038958881

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,217,399 - 207,232,098 (-)	NCBI
mRatBN7.2	2	204,533,877 - 204,547,177 (-)	NCBI

RefSeq Acc Id:

XM_063282406 ⟹ XP_063138476

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,217,399 - 207,231,393 (-)	NCBI

RefSeq Acc Id:

XM_063282407 ⟹ XP_063138477

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,219,816 - 207,231,677 (-)	NCBI

RefSeq Acc Id:

XM_063282408 ⟹ XP_063138478

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,219,816 - 207,231,677 (-)	NCBI

RefSeq Acc Id:

XR_010063655

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,219,816 - 207,231,677 (-)	NCBI

RefSeq Acc Id:

XR_010063656

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	207,220,075 - 207,231,677 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001029074	(Get FASTA)	NCBI Sequence Viewer
	XP_038958872	(Get FASTA)	NCBI Sequence Viewer
	XP_038958875	(Get FASTA)	NCBI Sequence Viewer
	XP_038958876	(Get FASTA)	NCBI Sequence Viewer
	XP_038958877	(Get FASTA)	NCBI Sequence Viewer
	XP_038958878	(Get FASTA)	NCBI Sequence Viewer
	XP_038958881	(Get FASTA)	NCBI Sequence Viewer
	XP_063138476	(Get FASTA)	NCBI Sequence Viewer
	XP_063138477	(Get FASTA)	NCBI Sequence Viewer
	XP_063138478	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI03657	(Get FASTA)	NCBI Sequence Viewer
	AAI66503	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000062314
	ENSRNOP00000062314.2

RefSeq Acc Id:

NP_001029074 ⟸ NM_001033902

- UniProtKB:

B2GV29 (UniProtKB/TrEMBL), F1MAP3 (UniProtKB/TrEMBL), A6HVA0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEAPAPTTPAIGFPTDGRCNYFVEKKKRFCRMVVAAGKRFCGEHAGSAEEENARKRILCPLDPK
HTVYEDQLAKHLKKCNSREKPKPDFFIQDINAGLKDETEILEQLVPLSSLSEEQLETLIKKLRK
ASEGLNSTHEDHIMSHPALHDALNDPRNGDCAVKHLKQQASILGNIEKLKLLGPRRCFVEFGAG
KGKLSHWVDIALKDAENVHFILVEKVTTRFKVDGKHRKKNSVFERLQIDIQHLCLNRLPVLREG
RLPVVGIGKHLCGVATDLALRCLVETYAASFKEKDEEPLAKRVKNDKTEKESNTLAKEGSEKDV
PETRTPVAGIVIALCCHHRCDWRHYVGKEYFKALGLGAVEFYYFQRMSSWATCGMRTSLEASDV
TAERKDAQKDEEEEHDDVGDRLTDGSTDSLPGTLTVEEKKKIGHLCKLLIDQGRLQYLQQKGFS
PALQYYTDPLVSLENVLLTAVPAHLSSQEKNQSVKGNMNMMSSTSKK

hide sequence

Ensembl Acc Id:

ENSRNOP00000062314 ⟸ ENSRNOT00000064484

RefSeq Acc Id:	XP_038958876 ⟸ XM_039102948
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038958877 ⟸ XM_039102949
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038958875 ⟸ XM_039102947
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038958881 ⟸ XM_039102953
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038958872 ⟸ XM_039102944
- Peptide Label:	isoform X1
- UniProtKB:	A6HVA0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038958878 ⟸ XM_039102950
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063138476 ⟸ XM_063282406
- Peptide Label:	isoform X2
- UniProtKB:	A6HVA0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063138478 ⟸ XM_063282408
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_063138477 ⟸ XM_063282407
- Peptide Label:	isoform X4

Protein Domains

CHHC U11-48K-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2GV29-F1-model_v2	AlphaFold	B2GV29	1-495	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565211	AgrOrtholog
BioCyc Gene	G2FUF-51495	BioCyc
BioCyc Pathway	PWY-6829 [tRNA methylation (yeast)]	BioCyc
BioCyc Pathway Image	PWY-6829	BioCyc
Ensembl Genes	ENSRNOG00000015140	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000064484	ENTREZGENE
	ENSRNOT00000064484.5	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7122476	IMAGE-MGC_LOAD
InterPro	Methyltransferase_TRM13	UniProtKB/TrEMBL
	Trm13	UniProtKB/TrEMBL
	TRM13/UPF0224_CHHC_Znf_dom	UniProtKB/TrEMBL
	Znf_CCCH-type_TRM13	UniProtKB/TrEMBL
KEGG Report	rno:499697	UniProtKB/TrEMBL
MGC_CLONE	MGC:188066	IMAGE-MGC_LOAD
NCBI Gene	499697	ENTREZGENE
PANTHER	PTHR12998	UniProtKB/TrEMBL
	TRNA:M(4)X MODIFICATION ENZYME TRM13 HOMOLOG	UniProtKB/TrEMBL
Pfam	TRM13	UniProtKB/TrEMBL
	UPF0224	UniProtKB/TrEMBL
	zf-TRM13_CCCH	UniProtKB/TrEMBL
PhenoGen	Trmt13	PhenoGen
PROSITE	ZF_CHHC_U11_48K	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000015140	RatGTEx
UniProt	A6HVA0	ENTREZGENE, UniProtKB/TrEMBL
	B2GV29	ENTREZGENE, UniProtKB/TrEMBL
	F1MAP3	ENTREZGENE
	Q3ZAU3_RAT	UniProtKB/TrEMBL
UniProt Secondary	F1MAP3	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2025-11-13	Trmt13	tRNA methyltransferase 13	Trmt13	tRNA methyltransferase 13 homolog	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-04-14	Trmt13	tRNA methyltransferase 13 homolog	Trmt13	tRNA methyltransferase 13	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-04-13	Trmt13	tRNA methyltransferase 13	Trmt13	tRNA methyltransferase 13 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-13	Trmt13	tRNA methyltransferase 13 homolog (S. cerevisiae)	Ccdc76	coiled-coil domain containing 76	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-06	Ccdc76	coiled-coil domain containing 76	MGC124992	similar to hypothetical protein FLJ10287	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	MGC124992	similar to hypothetical protein FLJ10287			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

BioCyc Pathways