Advanced Search (OLGA)

Gene: Atoh1 (atonal bHLH transcription factor 1) Rattus norvegicus

Analyze

Symbol:

Atoh1

Name:

atonal bHLH transcription factor 1

RGD ID:

1565171

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific; E-box binding activity; and chromatin DNA binding activity. Predicted to be involved in several processes, including negative regulation of gliogenesis; neuron differentiation; and positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including generation of neurons; neuroblast migration; and positive regulation of inner ear auditory receptor cell differentiation. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 89. Orthologous to human ATOH1 (atonal bHLH transcription factor 1); INTERACTS WITH 2,2',4,4',5,5'-hexachlorobiphenyl; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

atonal homolog 1; atonal homolog 1 (Drosophila); LOC500156; RGD1565171; similar to MATH-1 protein; transcription factor ATOH1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATOH1 (atonal bHLH transcription factor 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Atoh1 (atonal bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Atoh1 (atonal bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATOH1 (atonal bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ATOH1 (atonal bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atoh1 (atonal bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ATOH1 (atonal bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ATOH1 (atonal bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atoh1 (atonal bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Atoh1 (atonal bHLH transcription factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ATOH1 (atonal bHLH transcription factor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Atoh1 (atonal bHLH transcription factor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	atoh1b (atonal bHLH transcription factor 1b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Danio rerio (zebrafish):	atoh1a (atonal bHLH transcription factor 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	atoh1c (atonal bHLH transcription factor 1c)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	amos	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	cato	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	lin-32	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	ato	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	atoh1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	atoh1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ube2e2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	95,241,933 - 95,244,028 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	95,241,933 - 95,244,019 (+)	Ensembl				GRCr8
mRatBN7.2	4	93,912,068 - 93,914,163 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	93,912,068 - 93,914,154 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	99,138,821 - 99,140,918 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	94,913,774 - 94,915,871 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	93,336,612 - 93,338,707 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	95,498,003 - 95,500,098 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	95,498,003 - 95,500,089 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	160,284,441 - 160,286,536 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	94,109,650 - 94,111,745 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	88,659,055 - 88,661,150 (+)	NCBI		Celera
Cytogenetic Map	4	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant nonsyndromic deafness (ISO)

autosomal dominant nonsyndromic deafness 89 (ISO)

Developmental Disabilities (ISO)

Hearing Loss (ISO)

medulloblastoma (ISO)

pontocerebellar hypoplasia (ISO)

pontocerebellar hypoplasia type 1B (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (EXP,ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

CGP 52608 (ISO)

Cuprizon (EXP)

diarsenic trioxide (ISO)

dihydro-beta-erythroidine (ISO)

folic acid (ISO)

formaldehyde (ISO)

nicotine (ISO)

paracetamol (ISO)

PCB138 (ISO)

sodium arsenite (ISO)

Theaflavin 3,3'-digallate (ISO)

trichloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

auditory receptor cell fate determination (ISO)

auditory receptor cell fate specification (ISO)

axon development (IBA)

axon guidance (ISO)

brain development (ISO)

cell differentiation (IEA,ISO)

cerebral cortex development (ISO)

DNA-templated transcription (IEA)

inner ear auditory receptor cell differentiation (ISO)

inner ear development (ISO)

inner ear morphogenesis (ISO)

negative regulation of apoptotic process (ISO)

negative regulation of gliogenesis (IEA,ISO)

nervous system development (IEA)

neuron differentiation (ISO)

neuron fate commitment (IBA)

neuron migration (ISO)

Notch signaling pathway (ISO)

positive regulation of inner ear auditory receptor cell differentiation (ISO)

positive regulation of inner ear receptor cell differentiation (IEA,ISO)

positive regulation of neuron differentiation (IEA,ISO)

positive regulation of transcription by RNA polymerase II (IBA,ISO)

regulation of neuron differentiation (ISO)

sensory organ development (IBA)

system development (IEA)

Cellular Component

nucleus (IBA,IEA,ISO)

Molecular Function

chromatin DNA binding (IEA,ISO)

DNA binding (IEA,ISO)

DNA-binding transcription activator activity, RNA polymerase II-specific (IEA,ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

E-box binding (IBA)

protein binding (ISO)

protein dimerization activity (IEA)

RNA polymerase II cis-regulatory region sequence-specific DNA binding (IEA,ISO)

sequence-specific DNA binding (IEA,ISO)

sequence-specific double-stranded DNA binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10364557	PMID:10648228	PMID:11023859	PMID:11973280	PMID:12208538	PMID:12223565	PMID:14757642	PMID:14999071	PMID:15543141	PMID:15788459	PMID:16145671	PMID:16202707
PMID:16325379	PMID:16407553	PMID:16679559	PMID:17826772	PMID:19154718	PMID:21146598	PMID:22423092	PMID:23669638	PMID:25535395	PMID:28576729	PMID:31945449

Genomics

Comparative Map Data

Atoh1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	95,241,933 - 95,244,028 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	95,241,933 - 95,244,019 (+)	Ensembl				GRCr8
mRatBN7.2	4	93,912,068 - 93,914,163 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	93,912,068 - 93,914,154 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	99,138,821 - 99,140,918 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	94,913,774 - 94,915,871 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	93,336,612 - 93,338,707 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	95,498,003 - 95,500,098 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	95,498,003 - 95,500,089 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	160,284,441 - 160,286,536 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	94,109,650 - 94,111,745 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	88,659,055 - 88,661,150 (+)	NCBI		Celera
Cytogenetic Map	4	q31	NCBI

ATOH1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	93,828,753 - 93,830,964 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	93,828,753 - 93,830,964 (+)	Ensembl			hg38	GRCh38
GRCh37	4	94,749,904 - 94,752,115 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	94,969,101 - 94,970,165 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	4	95,107,255 - 95,108,320	NCBI
Celera	4	92,046,181 - 92,047,245 (+)	NCBI		Celera
Cytogenetic Map	4	q22.2	NCBI
HuRef	4	90,487,368 - 90,488,432 (+)	NCBI		HuRef
CHM1_1	4	94,726,590 - 94,727,654 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	97,144,124 - 97,146,335 (+)	NCBI		T2T-CHM13v2.0

Atoh1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	64,706,109 - 64,708,229 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	64,706,109 - 64,708,229 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	64,729,125 - 64,731,245 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	64,729,125 - 64,731,245 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	64,679,140 - 64,681,237 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	64,658,735 - 64,660,821 (+)	NCBI		MGSCv36	mm8
Celera	6	66,856,661 - 66,858,758 (+)	NCBI		Celera
Cytogenetic Map	6	C1	NCBI
cM Map	6	30.03	NCBI

Atoh1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	4,461,704 - 4,462,756 (+)	Ensembl
ChiLan1.0	NW_004955405	4,461,704 - 4,462,756 (+)	NCBI	ChiLan1.0	ChiLan1.0

ATOH1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	91,853,914 - 91,856,688 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	92,132,530 - 92,135,303 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	86,188,534 - 86,191,301 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	96,863,733 - 96,864,905 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	96,863,762 - 96,864,832 (+)	Ensembl			panPan2	panpan1.1

ATOH1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	16,807,217 - 16,809,294 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	16,807,336 - 16,808,406 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	32	25,139,203 - 25,141,513 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	32	16,985,533 - 16,987,838 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	16,985,749 - 16,986,819 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	32	16,957,560 - 16,959,866 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	16,773,311 - 16,775,500 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	23,118,806 - 23,121,117 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Atoh1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405301	24,908,942 - 24,911,175 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936687	1,436,009 - 1,437,067 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936687	1,435,977 - 1,437,138 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATOH1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	125,768,286 - 125,770,545 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	8	125,768,232 - 125,770,619 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	135,103,515 - 135,105,739 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATOH1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	42,098,057 - 42,104,910 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	42,100,996 - 42,102,060 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666037	20,456,111 - 20,458,324 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atoh1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624757	21,517,809 - 21,518,864 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624757	21,517,650 - 21,519,543 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Atoh1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	77,939,477 - 77,941,402 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Atoh1
4 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	62
Count of miRNA genes:	62
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000008358
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	86583980	149763391	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	59753119	104753119	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	92406430	137406430	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	80212111	119233320	Rat
1358363	Sradr3	Stress Responsive Adrenal Weight QTL 3	6.19		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	58817672	103817672	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	71647492	116647492	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82944895	154403548	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	75939858	140508796	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	65060960	127749483	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
2317587	Eae26	Experimental allergic encephalomyelitis QTL 26			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	4	89986808	101226978	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	51085655	113588029	Rat
61364	Iddm2	Insulin dependent diabetes mellitus QTL 2			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	80216705	104243248	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	88883695	133883695	Rat
2317588	Eae27	Experimental allergic encephalomyelitis QTL 27			nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	69036742	114036742	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	40490442	117737312	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
4889969	Bss96	Bone structure and strength QTL 96	4.9		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	4	57613242	102613242	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	88883695	133883695	Rat
4889972	Bss97	Bone structure and strength QTL 97	5.6		tibia size trait (VT:0100001)	tibia total bone volume (CMO:0001724)	4	57613242	102613242	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
5685009	Bmd86	Bone mineral density QTL 86	3.7		tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	4	57613242	102613242	Rat
2306794	Ean2	Experimental allergic neuritis QTL 2	6.4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	4	82790777	97183061	Rat
2306547	Iddm38	Insulin dependent diabetes mellitus QTL 38			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	68353567	113353567	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
2306545	Iddm39	Insulin dependent diabetes mellitus QTL 39			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	78687630	123687630	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	74169813	134199155	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	86058928	131411333	Rat
2312569	Pur19	Proteinuria QTL 19	3.4	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	4	59836842	104836842	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	75939858	140508796	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	84349032	129349032	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	64209744	109209744	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63245026	129846354	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	57664252	127749483	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	82336765	127336765	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	86583980	131583980	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63224393	108224393	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat

Markers in Region

BB385668

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	93,914,017 - 93,914,119 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	95,499,953 - 95,500,054	NCBI	Rnor6.0
Rnor_5.0	4	160,286,391 - 160,286,492	UniSTS	Rnor5.0
RGSC_v3.4	4	94,111,600 - 94,111,701	UniSTS	RGSC3.4
Celera	4	88,661,005 - 88,661,106	UniSTS
Cytogenetic Map	4	q31	UniSTS

UniSTS:546664

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	93,912,293 - 93,913,874 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	95,498,229 - 95,499,809	NCBI	Rnor6.0
Rnor_5.0	4	160,284,667 - 160,286,247	UniSTS	Rnor5.0
Celera	4	88,659,281 - 88,660,861	UniSTS
Cytogenetic Map	4	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	4	51	8	5	1	1	1	5	31	8	45	6	41	4	2	2

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109238	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008358 ⟹ ENSRNOP00000008358

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	95,241,933 - 95,244,019 (+)	Ensembl
mRatBN7.2 Ensembl	4	93,912,068 - 93,914,154 (+)	Ensembl
Rnor_6.0 Ensembl	4	95,498,003 - 95,500,089 (+)	Ensembl

RefSeq Acc Id:

NM_001109238 ⟹ NP_001102708

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	95,241,933 - 95,244,028 (+)	NCBI
mRatBN7.2	4	93,912,068 - 93,914,163 (+)	NCBI
Rnor_6.0	4	95,498,003 - 95,500,098 (+)	NCBI
Rnor_5.0	4	160,284,441 - 160,286,536 (+)	NCBI
RGSC_v3.4	4	94,109,650 - 94,111,745 (+)	RGD
Celera	4	88,659,055 - 88,661,150 (+)	RGD

Sequence:

show sequence

CGGAGAAGCTTCGTTGCACGCGACCTGGTGTGCGATCTCCGAGTGAGAGGGGGAGGGTGAGAGG
AGAAAAAAAAAATCAGACCTTGCAGAAGAGACTAGGAAGGTTTTTGTTGTTGTTGTTCGGGGCT
TTCCCCCTTCGTTGAACTGGGTTGCCAGCACCTCCTCTAACAAGGCACCTCCGAGCCAGTGCAT
TGCGATGTCCCGCCTGCTGCATGCAGAAGAGTGGGCTGAGGTAAAAGAGTTGGGGGACCACCAT
CGCCATCCCCAGCCGCACCACATCCCTCAGCTGACGCCACAGCCACCTGCTACCCTACAGGCGA
GAGACCATCCGGTCTACCCGGCAGAACTGTCCCTCCTGGATAGCACCGACCCACGCGCCTGGCT
GACTCCCACTTTGCAGGGCCTCTGCACGGCACGCGCCGCCCAGTATCTGCTGCATTCTCCCGAG
CTGGGTGCCTCCGAGGCCGCGGCGCCCGGGGACGAGGCTGACGGCCAGGGTGAGCTGGTAAGGA
GAAGCGGCTGCGGCGGCCTCAGCAAGAGCCCCGGGCCGGTGAAAGTGCGGGAACAACTGTGCAA
GCTGAAGGGCGGGGTTGTAGTAGACGAGCTGGGCTGCAGCCGCCAGCGAGCCCCTTCCAGCAAA
CAGGTGAATGGGGTACAGAAGCAAAGGCGACTGGCAGCAAACGCAAGGGAGCGGCGCAGGATGC
ACGGGCTGAACCACGCCTTCGACCAGCTGCGCAACGTTATCCCGTCCTTCAACAACGACAAGAA
GCTGTCCAAATATGAGACCCTGCAGATGGCCCAGATCTACATCAACGCCCTGTCGGAGTTGCTG
CAGACTCCCAGTGTCGGAGAGCAGCCACCGCCGCCAGCAGCCTCCTGCAAAAATGACCACCATC
ACCTTCGCGCAGCCGCCTCTTATGAAGGAGGAGCAGGCGCCTCTGCGGTAGCTGGGGCTCAGCC
AGCCCCGGGAGGGGGCCCGAGACCCACCCCGCCTGGAGCTTGCCGGACTCGCTTCTCCACCCCA
GCTTCCTCCGGGGGTTATTCAGTGCAGCTGGACGCTTTGCACTTTCCAGCTTTCGAGGACCGGG
CCCTAACAGCGATGATGGCACAGAAGGACCTGTCGCCTTCGCTGCCCGGGGGCATCCTGCAGCC
AGTACCGGAGGACAGCAGCAAAACATCTCCCAGGTCCCACAGAAGTGACGGAGAGTTTTCCCCC
CACTCTCATTACAGTGACTCTGACGAGGCCAGTTAGGAAGACAACAGCACCCTGAAAACTGAGA
CAACCAAAAGCCCTTCCCAGCGCGCGGGGAAGTCCCGCGACAAATATCCCTTCCACCACCCTTT
AATTTTTGCTCTACGTGATCTTTGTTAGCAACGATGTGACTTCGGAGGGCTGCGGCTCTTCCAA
ACCCCTTCCTCCTACCTTCTGCTTCCTCTGTATATAGATTCAGTGTCATTATATGTACCTTTAC
ATGTCATCGTCCCATAGTCCGTGCTGCCAATATGCTGCTAAAATGTCGTATCTCTGTCTCTGGT
CTGGGTTTCACTTAATTTTATACCTTGGGCGTTCATCCTGGTGTGTTGCGCTCACTCACTCGTA
AGGGAGTTAGTCTTCGAAGTTGTTTCCCCAAGCGCATTCGGTGCTTAACTGAACACGAACTATT
GAGTTGTTAAAATGCATGGGACAGATAAGAGAATCTGTAGAGCTTAAACACCGAGTGTGTCTAG
CGGACCCAGAACACGCACTTCATCACTGGCTGCTGTGCCGCCTTGAAGAAACTCAACTGCCAAT
TGCAGACCAACTTTTGATTTTAAAAATAGCCACTCGTAATCCTTAAACTCTTTGCAAATGTTTG
TTTTTGCAAATGAAAATTAAAAAAACATGTAGTGTCAAAGGCATTTGGTCAATTTTATTTTGCT
TTGTTAACATTAGAAAAGTTATTTATTATCGCGTATTTGGACCCATTTCTACTTATTTGCTTTT
TTTTTTTACATTTTCTACTCGAGATCATTTTATTTTGATTTAGCAAATCCAGTTGCCATTGATT
TATGTATGTATGCTCTTTACAAATGATAAAATAAACTTGAAAAAACCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102708	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL91604	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000008358
	ENSRNOP00000008358.3

RefSeq Acc Id:

NP_001102708 ⟸ NM_001109238

- UniProtKB:

D3ZQL9 (UniProtKB/TrEMBL), A6KF20 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSRLLHAEEWAEVKELGDHHRHPQPHHIPQLTPQPPATLQARDHPVYPAELSLLDSTDPRAWLT
PTLQGLCTARAAQYLLHSPELGASEAAAPGDEADGQGELVRRSGCGGLSKSPGPVKVREQLCKL
KGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKL
SKYETLQMAQIYINALSELLQTPSVGEQPPPPAASCKNDHHHLRAAASYEGGAGASAVAGAQPA
PGGGPRPTPPGACRTRFSTPASSGGYSVQLDALHFPAFEDRALTAMMAQKDLSPSLPGGILQPV
PEDSSKTSPRSHRSDGEFSPHSHYSDSDEAS

hide sequence

Ensembl Acc Id:

ENSRNOP00000008358 ⟸ ENSRNOT00000008358

Protein Domains

bHLH

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZQL9-F1-model_v2	AlphaFold	D3ZQL9	1-351	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693095

Promoter ID:

EPDNEW_R3620

Type:

single initiation site

Name:

Atoh1_1

Description:

atonal bHLH transcription factor 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	95,498,004 - 95,498,064	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565171	AgrOrtholog
BioCyc Gene	G2FUF-44613	BioCyc
Ensembl Genes	ENSRNOG00000006383	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000008358	ENTREZGENE
	ENSRNOT00000008358.8	UniProtKB/TrEMBL
Gene3D-CATH	4.10.280.10	UniProtKB/TrEMBL
InterPro	ATOH1	UniProtKB/TrEMBL
	bHLH_transcription_factors	UniProtKB/TrEMBL
	HLH_DNA-bd	UniProtKB/TrEMBL
	HLH_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	rno:500156	UniProtKB/TrEMBL
NCBI Gene	500156	ENTREZGENE
PANTHER	BASIC HELIX-LOOP-HELIX PROTEIN NEUROGENIN-RELATED	UniProtKB/TrEMBL
	PTHR19290:SF82	UniProtKB/TrEMBL
Pfam	HLH	UniProtKB/TrEMBL
PhenoGen	Atoh1	PhenoGen
PROSITE	HLH	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000006383	RatGTEx
SMART	HLH	UniProtKB/TrEMBL
Superfamily-SCOP	HLH_basic	UniProtKB/TrEMBL
UniProt	A6KF20	ENTREZGENE, UniProtKB/TrEMBL
	D3ZQL9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-06-24	Atoh1	atonal bHLH transcription factor 1	Atoh1	atonal homolog 1 (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Atoh1	atonal homolog 1 (Drosophila)	RGD1565171_predicted	similar to MATH-1 protein (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1565171_predicted	similar to MATH-1 protein (predicted)	LOC500156	similar to MATH-1 protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC500156	similar to MATH-1 protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM