Advanced Search (OLGA)

Gene: C10h16orf89 (similar to human chromosome 16 open reading frame 89) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

C10h16orf89

Name:

similar to human chromosome 16 open reading frame 89

RGD ID:

1565166

Description:

Predicted to enable protein homodimerization activity. Predicted to be active in cytosol and membrane. Orthologous to human C16orf89 (chromosome 16 open reading frame 89); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC287059; LOC287059; RGD1565166; similar to MGC45438 protein; uncharacterized protein LOC287059; UPF0764 protein C16orf89 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	10,856,320 - 10,877,515 (+)	NCBI		GRCr8
mRatBN7.2	10	10,361,909 - 10,371,046 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	10,361,948 - 10,371,046 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	15,068,671 - 15,077,802 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	14,557,481 - 14,566,612 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	10,226,421 - 10,235,585 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	10,555,337 - 10,564,433 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	10,555,337 - 10,564,433 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	9,313,103 - 9,334,297 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	10,476,014 - 10,485,110 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	9,327,992 - 9,337,089 (+)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C10h16orf89	Rat	Rubinstein-Taybi syndrome		ISO	C16orf89 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Rubinstein-Taybi syndrome	ClinVar	PMID:18688873 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C10h16orf89	Rat	2,2',5,5'-tetrachlorobiphenyl	increases expression	ISO	C16orf89 (Homo sapiens)	6480464	2 more ...	CTD	PMID:36804509
C10h16orf89	Rat	2,2',5,5'-tetrachlorobiphenyl	decreases expression	ISO	C16orf89 (Homo sapiens)	6480464	2 more ...	CTD	PMID:36804509
C10h16orf89	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of C10H16ORF89 mRNA	CTD	PMID:33387578
C10h16orf89	Rat	3,3',4,4',5-pentachlorobiphenyl	decreases expression	EXP		6480464	3 more ...	CTD	PMID:32119087
C10h16orf89	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	AU021092 (Mus musculus)	6480464	Fenretinide results in increased expression of C16ORF89 mRNA	CTD	PMID:28973697
C10h16orf89	Rat	benzo[a]pyrene	decreases expression	ISO	C16orf89 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of C16ORF89 mRNA	CTD	PMID:22316170
C10h16orf89	Rat	benzo[a]pyrene	decreases methylation	ISO	C16orf89 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of C16ORF89 promoter	CTD	PMID:27901495
C10h16orf89	Rat	benzo[e]pyrene	increases methylation	ISO	C16orf89 (Homo sapiens)	6480464	benzo(e)pyrene results in increased methylation of C16ORF89 5' UTR	CTD	PMID:30157460
C10h16orf89	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of C16ORF89 mRNA	CTD	PMID:25181051
C10h16orf89	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of C10H16ORF89 mRNA	CTD	PMID:30816183 and PMID:32528016
C10h16orf89	Rat	cefaloridine	increases expression	EXP		6480464	Cephaloridine results in increased expression of C10H16ORF89 mRNA	CTD	PMID:18500788
C10h16orf89	Rat	dorsomorphin	multiple interactions	ISO	C16orf89 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of C16ORF89 mRNA	CTD	PMID:27188386
C10h16orf89	Rat	entinostat	multiple interactions	ISO	C16orf89 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of C16ORF89 mRNA	CTD	PMID:27188386
C10h16orf89	Rat	entinostat	increases expression	ISO	C16orf89 (Homo sapiens)	6480464	entinostat results in increased expression of C16ORF89 mRNA	CTD	PMID:26272509
C10h16orf89	Rat	methamphetamine	decreases expression	EXP		6480464	Methamphetamine results in decreased expression of C10H16ORF89 mRNA	CTD	PMID:19564919
C10h16orf89	Rat	methamphetamine	multiple interactions	EXP		6480464	[Methamphetamine co-treated with SCH 23390] results in decreased expression of C10H16ORF89 mRNA	CTD	PMID:19564919
C10h16orf89	Rat	methapyrilene	increases methylation	ISO	C16orf89 (Homo sapiens)	6480464	Methapyrilene results in increased methylation of C16ORF89 5' UTR	CTD	PMID:30157460
C10h16orf89	Rat	nickel atom	decreases expression	ISO	C16orf89 (Homo sapiens)	6480464	Nickel results in decreased expression of C16ORF89 mRNA	CTD	PMID:24768652 and PMID:25583101
C10h16orf89	Rat	paracetamol	decreases expression	ISO	C16orf89 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of C16ORF89 mRNA	CTD	PMID:22230336
C10h16orf89	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of C10H16ORF89 mRNA	CTD	PMID:32680482
C10h16orf89	Rat	resveratrol	multiple interactions	ISO	C16orf89 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of C16ORF89 mRNA	CTD	PMID:23557933
C10h16orf89	Rat	SB 431542	multiple interactions	ISO	C16orf89 (Homo sapiens)	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of C16ORF89 mRNA	CTD	PMID:27188386
C10h16orf89	Rat	SCH 23390	multiple interactions	EXP		6480464	[Methamphetamine co-treated with SCH 23390] results in decreased expression of C10H16ORF89 mRNA	CTD	PMID:19564919
C10h16orf89	Rat	SCH 23390	decreases expression	EXP		6480464	SCH 23390 results in decreased expression of C10H16ORF89 mRNA	CTD	PMID:19564919
C10h16orf89	Rat	silicon dioxide	decreases expression	ISO	C16orf89 (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of C16ORF89 mRNA	CTD	PMID:23806026
C10h16orf89	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of C10H16ORF89 mRNA	CTD	PMID:33387578
C10h16orf89	Rat	valproic acid	affects expression	ISO	C16orf89 (Homo sapiens)	6480464	Valproic Acid affects the expression of C16ORF89 mRNA	CTD	PMID:25979313
C10h16orf89	Rat	valproic acid	increases methylation	ISO	C16orf89 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of C16ORF89 gene	CTD	PMID:29154799
C10h16orf89	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of C10H16ORF89 mRNA	CTD	PMID:22615374

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C10h16orf89	Rat	cytosol	located_in	ISO	C16orf89 (Homo sapiens)	1624291	PMID:20578903	RGD	PMID:20578903
C10h16orf89	Rat	cytosol	is_active_in	IBA	PANTHER:PTN002128707 and UniProtKB:Q6UX73	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
C10h16orf89	Rat	cytosol	located_in	IEA	UniProtKB:Q6UX73 and ensembl:ENSP00000420566	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
C10h16orf89	Rat	membrane	located_in	ISO	C16orf89 (Homo sapiens)	1624291	PMID:20578903	RGD	PMID:20578903
C10h16orf89	Rat	membrane	located_in	IEA	UniProtKB:Q6UX73 and ensembl:ENSP00000420566	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
C10h16orf89	Rat	membrane	is_active_in	IBA	PANTHER:PTN002128707 and UniProtKB:Q6UX73	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
C10h16orf89	Rat	protein homodimerization activity	enables	ISO	C16orf89 (Homo sapiens)	1624291	UniProtKB:Q6UX73 and PMID:20578903	RGD	PMID:20578903
C10h16orf89	Rat	protein homodimerization activity	enables	IEA	UniProtKB:Q6UX73 and ensembl:ENSP00000420566	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:19056867	PMID:20578903	PMID:23376485	PMID:23533145

C10h16orf89
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	10,856,320 - 10,877,515 (+)	NCBI		GRCr8
mRatBN7.2	10	10,361,909 - 10,371,046 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	10,361,948 - 10,371,046 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	15,068,671 - 15,077,802 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	14,557,481 - 14,566,612 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	10,226,421 - 10,235,585 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	10,555,337 - 10,564,433 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	10,555,337 - 10,564,433 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	9,313,103 - 9,334,297 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	10,476,014 - 10,485,110 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	9,327,992 - 9,337,089 (+)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

C16orf89
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	5,042,772 - 5,065,956 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	5,044,122 - 5,066,110 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	5,094,123 - 5,115,957 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	5,034,124 - 5,056,112 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	16	5,303,508 - 5,325,498 (-)	NCBI		Celera
Cytogenetic Map	16	p13.3	NCBI
HuRef	16	5,060,189 - 5,082,211 (-)	NCBI		HuRef
CHM1_1	16	5,095,334 - 5,117,334 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	5,072,272 - 5,095,444 (-)	NCBI		T2T-CHM13v2.0

AU021092
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	5,029,677 - 5,040,170 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	5,029,687 - 5,040,163 (-)	Ensembl		GRCm39 Ensembl
GRCm38	16	5,211,814 - 5,222,308 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	5,211,823 - 5,222,299 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	5,211,912 - 5,222,392 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	5,127,147 - 5,137,601 (-)	NCBI		MGSCv36	mm8
Celera	16	5,844,837 - 5,855,314 (-)	NCBI		Celera
Cytogenetic Map	16	A1	NCBI
cM Map	16	2.51	NCBI

CUNH16orf89
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955442	12,496,527 - 12,508,802 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955442	12,496,862 - 12,507,655 (+)	NCBI	ChiLan1.0	ChiLan1.0

C18H16orf89
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	5,571,392 - 5,594,001 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	9,361,729 - 9,384,330 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	3,967,203 - 3,990,077 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	5,131,629 - 5,153,316 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	5,132,090 - 5,153,079 (-)	Ensembl	panpan1.1		panPan2

C6H16orf89
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	36,388,221 - 36,402,847 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	36,388,165 - 36,402,860 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	37,778,562 - 37,794,456 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	36,590,239 - 36,604,802 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	36,590,156 - 36,604,815 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	36,388,880 - 36,403,412 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	36,280,052 - 36,294,599 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	36,680,313 - 36,694,835 (+)	NCBI		UU_Cfam_GSD_1.0

CUNH16orf89
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	107,083,493 - 107,102,698 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936530	4,936,064 - 4,948,079 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936530	4,936,034 - 4,948,076 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C3H16orf89
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	37,346,532 - 37,365,357 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	37,346,530 - 37,365,367 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	38,352,463 - 38,371,273 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CUNH16orf89
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	4,714,323 - 4,735,290 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	4,714,313 - 4,734,915 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666068	25,918,962 - 25,940,342 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

CUNH16orf89
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624824	2,842,238 - 2,852,027 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624824	2,838,681 - 2,854,521 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in C10h16orf89
35 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	64
Count of miRNA genes:	57
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000032495
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
631660	Hcar1	Hepatocarcinoma resistance QTL 1	3.4	0.0001	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	10	6154182	15990232	Rat
1576304	Schws7	Schwannoma susceptibility QTL 7		0.0115	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	4765527	19816042	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	1	24158324	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	29497586	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
737820	Alc9	Alcohol consumption QTL 9	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	19233348	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
631828	Alc5	Alcohol consumption QTL 5	2.4		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	17245662	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	6	40	105	40	45	15	16	15	6	141	71	91	41	60	30


RefSeq Transcripts	NM_001105762	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005489707	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000032495 ⟹ ENSRNOP00000031136

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	10,361,948 - 10,371,046 (+)	Ensembl
Rnor_6.0 Ensembl	10	10,555,337 - 10,564,433 (+)	Ensembl

RefSeq Acc Id:

NM_001105762 ⟹ NP_001099232

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	10,868,419 - 10,877,515 (+)	NCBI
mRatBN7.2	10	10,361,948 - 10,371,046 (+)	NCBI
Rnor_6.0	10	10,555,337 - 10,564,433 (+)	NCBI
Rnor_5.0	10	9,313,103 - 9,334,297 (+)	NCBI
RGSC_v3.4	10	10,476,014 - 10,485,110 (+)	RGD
Celera	10	9,327,992 - 9,337,089 (+)	RGD

Sequence:

show sequence

TTGAGTGTGTGACCGTTCACCGTCTGCCAGCCCATCATGGCGAGGATCAGCCTGCTTCTACTCCTGCTGCTGTCCCTGCCACAGCAGCTCTCCTCACTGCCATGGCCAGACACTGCACAGGGCACCAT
GGCCGGCTTGATCCTGACTGCGTTAGAAAAAGCCACCTTATTTCTGGAGGACAGGCTGCCTAAAATCAACCTGGACGGTGCAGTGGGGTTCCAAGTGCTGGAAGTGCAACTCCGAGGAGTCCAGGAAA
AATGGGCTCACAACCCCTTGCTGCAGCCACTCAGCTTGCGTGCTGGACAGCTAGCCAACACACTGTTCGCTCTCCTCCAAAACTCCATCTTCTACCTCAAGCAGAGTGACCCCACATACCTAAGAGAG
TTCCAACCAAGCCTTCAGCCTGGCTTTTGGAAGTTGCCCCATGCCTGGACACGCACCAATGCCTCCCTGGTCTACCCCTGGCTGGAGCCCCTGGACTCTTTCTCGGAGGAAAGCAGCGATGCATGCCT
GGTACAACTGCTAGGAACCGGGACGGACAGCAGGCAGCCTTGCAGGCTCTCCGACTTCTGCAGAACCCTTATGACCAAGGCCGGCTGCTCAGGCTACAGCCTCTCCCATCAGCTGCTCTTCTTCCTCT
GGGCCAGAATGCAAGGGTGCACGGAGGGACTGTTCCTCCAGAGTCAGCACTACATTGACATCTTCTGTGCGAACATGATGGACCTGAACCGGAGAGCTGAGGCCATGGGATACGCCTACCCCACCCAA
GACCTCTTCATGGAAAACATTATGTTCTGTGGTATGGCTGGCTTCTCTGACTTCTACAAGCTGCACTGGCTGGAGGCCATTCTCAACTGGCAGAACCCTCAGGTGGGATGCTTCGGGAAGCCTGACAC
AAAGGGTGAACCCCCTGAAGTTCCGCATCGGCAGGGCGTTCTGAGAAGAGTGCGAAGGCGGGAAAAACTGTTCGAAGATGGCTGTTCTTGCCACAACACAGCCACTGCAGTCGCAGCCCTGGGTGGCT
TTCTCTACATCCTGGCAGAATACCACCCGGACAATGGAGAGCCAACTCCACCCACACGGTCACCAGCAAGCAACTATCAAGATGGTGCTGCCAGCCCTGATGCCCAGAGGATTGGCAGGCCCCTCAGC
ATCTCTTCTTAAATGCTGGAGTCAGGGGTCACATGCCAAGGGGGCATTTGAGGAAAGTGACCATGTATAACCCATCACCACTTCTGGGTATTTAAAAGTCTTGAGAGAGCAGGGCCAGGAGAGGCAGG
GTTAGAGGGTGGGGTGGTCCAGATGTCAGCAGAATACATAAAGCACTGTCAATTGGAGCTGAGCCTTCTGTCTTTTGTGCATATGTTATCAGATCATTAGTTGAGACAAGGTCTCACTGTGTATCCCT
GGCCGGACTGGAACTCACAGAGACCCTGCCTGCTTCTGCCTCCAACTGCTGGGATTACAAGTGCATGACCAGCTGTGTGTCAGATCTTGATGTGTAGTCTAGACTGGGTTCAAGATCCTCC

hide sequence

RefSeq Acc Id:

XM_063268523 ⟹ XP_063124593

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	10,856,320 - 10,877,323 (+)	NCBI

RefSeq Acc Id:

XM_063268524 ⟹ XP_063124594

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	10,868,373 - 10,876,540 (+)	NCBI

RefSeq Acc Id:

XR_005489707

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	10,868,377 - 10,874,481 (+)	NCBI
mRatBN7.2	10	10,361,909 - 10,370,047 (+)	NCBI


Protein RefSeqs	NP_001099232	(Get FASTA)	NCBI Sequence Viewer
	XP_063124593	(Get FASTA)	NCBI Sequence Viewer
	XP_063124594	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL96260	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000031136
	ENSRNOP00000031136.4

RefSeq Acc Id:	NP_001099232 ⟸ NM_001105762
- Peptide Label:	precursor
- UniProtKB:	D3ZFA0 (UniProtKB/TrEMBL), A6K4N8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARISLLLLLLLSLPQQLSSLPWPDTAQGTMAGLILTALEKATLFLEDRLPKINLDGAVGFQVLEVQLRGVQEKWAHNPLLQPLSLRAGQLANTLFALLQNSIFYLKQSDPTYLREFQPSLQPGFWKL PHAWTRTNASLVYPWLEPLDSFSEESSDACLVQLLGTGTDSRQPCRLSDFCRTLMTKAGCSGYSLSHQLLFFLWARMQGCTEGLFLQSQHYIDIFCANMMDLNRRAEAMGYAYPTQDLFMENIMFCGM AGFSDFYKLHWLEAILNWQNPQVGCFGKPDTKGEPPEVPHRQGVLRRVRRREKLFEDGCSCHNTATAVAALGGFLYILAEYHPDNGEPTPPTRSPASNYQDGAASPDAQRIGRPLSISS hide sequence

Ensembl Acc Id:

ENSRNOP00000031136 ⟸ ENSRNOT00000032495

RefSeq Acc Id:	XP_063124593 ⟸ XM_063268523
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063124594 ⟸ XM_063268524
- Peptide Label:	isoform X2

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZFA0-F1-model_v2	AlphaFold	D3ZFA0	1-375	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-26063	BioCyc
Ensembl Genes	ENSRNOG00000021796	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000032495	ENTREZGENE
	ENSRNOT00000032495.5	UniProtKB/TrEMBL
InterPro	DUF4735	UniProtKB/TrEMBL
KEGG Report	rno:287059	UniProtKB/TrEMBL
NCBI Gene	287059	ENTREZGENE
PANTHER	PTHR33539	UniProtKB/TrEMBL
	UPF0764 PROTEIN C16ORF89	UniProtKB/TrEMBL
Pfam	DUF4735	UniProtKB/TrEMBL
PhenoGen	C10h16orf89	PhenoGen
RatGTEx	ENSRNOG00000021796	RatGTEx
UniProt	A6K4N8	ENTREZGENE, UniProtKB/TrEMBL
	D3ZFA0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2023-09-19	C10h16orf89	similar to human chromosome 16 open reading frame 89	RGD1565166	similar to MGC45438 protein	Symbol and Name Changed	1299863	APPROVED
2008-04-30	RGD1565166	similar to MGC45438 protein	RGD1565166_predicted	similar to MGC45438 protein (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1565166_predicted	similar to MGC45438 protein (predicted)	LOC287059	similar to MGC45438 protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC287059	similar to MGC45438 protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar