Spem2 (SPEM family member 2) - Rat Genome Database

Name: Spem2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Spem2 (SPEM family member 2) Rattus norvegicus

Analyze

Symbol:

Spem2

Name:

SPEM family member 2

RGD ID:

1565061

Description:

Predicted to be located in membrane. Orthologous to human SPEM2 (SPEM family member 2); INTERACTS WITH bisphenol A; 3-isobutyl-1-methyl-7H-xanthine (ortholog); 4,4'-sulfonyldiphenol (ortholog).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC497938; LOC497938; similar to RIKEN cDNA 4933402P03; uncharacterized protein C17orf74 homolog; uncharacterized protein SPEM2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SPEM2 (SPEM family member 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):	Spem2 (SPEM family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Spem2 (SPEM family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SPEM2 (SPEM family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SPEM2 (SPEM family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Spem2 (SPEM family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SPEM2 (SPEM family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SPEM2 (SPEM family member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TRAT1 (T cell receptor associated transmembrane adaptor 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SPEM2 (SPEM family member 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Spem2 (SPEM family member 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	55,035,892 - 55,037,790 (-)	NCBI		GRCr8
mRatBN7.2	10	54,537,168 - 54,539,026 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	54,537,174 - 54,539,058 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	59,199,677 - 59,201,528 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	58,688,243 - 58,690,094 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	54,195,894 - 54,197,745 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	56,424,164 - 56,426,012 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	56,424,164 - 56,426,012 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	56,169,247 - 56,171,081 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	56,638,639 - 56,640,472 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	53,691,427 - 53,693,278 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

common variable immunodeficiency (ISO)

congenital myasthenic syndrome 2A (ISO)

dyskeratosis congenita (ISO)

intellectual disability (ISO)

Li-Fraumeni syndrome (ISO)

very long chain acyl-CoA dehydrogenase deficiency (ISO)

Weissenbacher-Zweymuller syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

dexamethasone (ISO)

indometacin (ISO)

sodium arsenite (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

membrane (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Genomics

Comparative Map Data

Spem2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	55,035,892 - 55,037,790 (-)	NCBI		GRCr8
mRatBN7.2	10	54,537,168 - 54,539,026 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	54,537,174 - 54,539,058 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	59,199,677 - 59,201,528 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	58,688,243 - 58,690,094 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	54,195,894 - 54,197,745 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	56,424,164 - 56,426,012 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	56,424,164 - 56,426,012 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	56,169,247 - 56,171,081 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	56,638,639 - 56,640,472 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	53,691,427 - 53,693,278 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

SPEM2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	7,425,616 - 7,427,568 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	7,425,616 - 7,427,568 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	7,328,935 - 7,330,887 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	7,269,659 - 7,271,611 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	17	7,354,821 - 7,356,773 (+)	NCBI		Celera
Cytogenetic Map	17	p13.1	NCBI
HuRef	17	7,222,961 - 7,224,913 (+)	NCBI		HuRef
CHM1_1	17	7,338,027 - 7,339,979 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	7,329,669 - 7,331,621 (+)	NCBI		T2T-CHM13v2.0

Spem2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	69,707,386 - 69,709,313 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	69,707,392 - 69,709,291 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	69,816,560 - 69,818,487 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	69,816,566 - 69,818,465 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	69,630,068 - 69,631,942 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	69,632,761 - 69,634,635 (-)	NCBI		MGSCv36	mm8
Celera	11	77,377,527 - 77,379,401 (-)	NCBI		Celera
Cytogenetic Map	11	B3	NCBI
cM Map	11	42.89	NCBI

Spem2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955467	9,498,541 - 9,500,466 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955467	9,493,708 - 9,500,466 (-)	NCBI	ChiLan1.0	ChiLan1.0

SPEM2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	15,019,413 - 15,024,166 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	16,985,222 - 16,989,970 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	7,458,605 - 7,461,545 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	7,445,958 - 7,447,907 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	7,449,092 - 7,453,041 (+)	Ensembl	panpan1.1		panPan2
PanPan1.1 Ensembl	17	7,445,958 - 7,447,907 (+)	Ensembl	panpan1.1		panPan2

SPEM2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	32,357,302 - 32,359,197 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	32,357,336 - 32,359,129 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	32,495,333 - 32,497,293 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	32,462,905 - 32,464,865 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	32,462,999 - 32,464,797 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	32,428,139 - 32,430,099 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	32,386,871 - 32,388,831 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	32,564,139 - 32,566,099 (+)	NCBI		UU_Cfam_GSD_1.0

Spem2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	47,232,222 - 47,236,485 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936595	708,799 - 710,604 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936595	708,694 - 710,810 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SPEM2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	52,728,826 - 52,730,822 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	52,729,001 - 52,731,131 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	55,021,617 - 55,023,538 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SPEM2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	6,800,970 - 6,803,726 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	6,801,835 - 6,803,655 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	14,604,873 - 14,607,257 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	51770177	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
1578762	Toxo1	Toxoplasma gondii resistance QTL 1			brain integrity trait (VT:0010579)	percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028)	10	52200030	59378278	Rat
1354585	Eae18a	Experimental allergic encephalomyelitis QTL 18a	7.5	0.0004	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	53797385	58445852	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	53797385	66979128	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium										7
Low	3			9				1		1
Below cutoff		17	6	9	6	3	5	18	10	7	9	3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001017475	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008767853	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008767854	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086583	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086584	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086586	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269626	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063269628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079298	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000084068 ⟹ ENSRNOP00000071516

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	54,537,174 - 54,539,058 (-)	Ensembl
Rnor_6.0 Ensembl	10	56,424,168 - 56,426,012 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000092506 ⟹ ENSRNOP00000075824

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	54,537,174 - 54,539,019 (-)	Ensembl
Rnor_6.0 Ensembl	10	56,424,164 - 56,426,012 (-)	Ensembl

RefSeq Acc Id:

NM_001017475 ⟹ NP_001017475

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,035,892 - 55,037,743 (-)	NCBI
mRatBN7.2	10	54,537,168 - 54,539,019 (-)	NCBI
Rnor_6.0	10	56,424,164 - 56,426,012 (-)	NCBI
Rnor_5.0	10	56,169,247 - 56,171,081 (-)	NCBI
RGSC_v3.4	10	56,638,639 - 56,640,472 (-)	RGD
Celera	10	53,691,427 - 53,693,278 (-)	RGD

Sequence:

show sequence

CCCAGGTGGCCTTAGGACCCCCCCACCATGGAAAACCAGTTGTGGCAGAGCACCCTGGGGTGCT
GCAGTCAATACCAAGAAAGCCCCCAGGATGCGGAGAACATCCTATTCCTGCTTCTGGGCCTCAT
CATTCTTGTCAACATCAGCATCAATGTGACAACTGTGATATGGCATGGGCTCCAGAATGCCATA
GACAAGATGTTCAGTCGGATGCATCAGAAGACAGCTGAAGTCCAGGTTACAGAGTGTCCCCCCA
AAGAGCCCCAACCAGCCAACGTCCAGGATGTCCACATCCACTGTGTCCTGGACCCTGTACAAGT
GAAGATGGCCCAACCCACACAGTGTTCCTCTTCCTCTACACACTATTTCCGGAAGCACTCTAAT
GACAGGCGCAGCCGCAGGCGCTACTGTTACCCACGGGGCAGCCTCCAGATCCGCCAAAGCAACC
AGCAACAGAGCTGCCACAGCCGTCAGCAGAGACTTCGGAACAACAGGCAATTCTCCCATGGCTA
CCCACCCTTCCGTAAACAGCGTCAAAGCCACAAGGCGTCACAGACGAGGCCAATGCCCTTCTTT
GATCTGGAAGACCGGGATTCCCTTCTGGAGGATGATCAGTCCTGCCCTCATCCCAAGCAACCCC
GTAGGAGCCGGGGTGGTTTGTATAAGCCAGTACGTCTGGCCTCCAATGCGGGACTGTGGGGTCG
CCAGGGTGGAATCCTCGCCAGCCTCCCACTACCCTCCCTCTACTTGTCACCAGAGATGCGCCGT
CTGCCTAAGCGAGTAGAAGCCAAATCAGAACTGAGGCTACAGGGCTTCGGTCCTCATTATTCAC
AGTCCCGGATTTGTGGTAATGTGGAAGCTGAGCAGTGGGCTTCATCACCACCTCCTCCCCGCCG
GCTGCTTCCTAACCCCTCCTGGGTCACTGTGGGTTATAGCCCTTTCCCTTCAGGGGGCCACATA
CCTTATGATGCCAGGGATCAGTGGAGGCGTGGGACCGAAGGCTGTGAGCCGCCACCTGCCTTTG
TATCCAGGAACCTCAGGTCAGATGCCCAAGGCTACCGGGACCACAGCTCCTCACAGGCCCACCG
GCAGAATTTTCCTAGCTATACCCACAGCCAACCCAACCACAGCCCACCACAGTCCGTGGGTTAT
AGCTCCCGGGAATCTCACGAAGTCCGCAGGCGGGCCCCTGACTGGAGTGAGGCTTTCCCCTCTC
GTCATCCTCTGACCACCTCTACCTCCCTCACTGCATTGGGTGAGGCTTCATACCAAAGGGCCCC
AACTGCCAGCTCGGGCCTGGTGATCCCTCACTCCTCCCAGCGCTTGGCAGAAGGCCAGATTTCA
GATCCAACCCCACCTGCAACCACCTTTGTACCACTCAGTCGGAATCCAGGTGGCAATGCCAACT
ACCAGGTGTATGACAGCCTGGAGCTGAAGAGGCAGGTGCAGGAGAACAGAGGGAGGGCCAGCTC
ACTGCCACCACCCTCCACCTCAGCTTCAAGGCCCTCTCTGCATAGAAGCCGGACAGGGAAACTT
AACTGAGCAGCAGGTGAATGTGAACAGTGGAGCAAGGCATGGAGAATAAAGAGAAAGAGTCCAG
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039086583 ⟹ XP_038942511

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,035,892 - 55,037,788 (-)	NCBI
mRatBN7.2	10	54,537,168 - 54,539,003 (-)	NCBI

RefSeq Acc Id:

XM_039086584 ⟹ XP_038942512

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,035,892 - 55,037,774 (-)	NCBI
mRatBN7.2	10	54,537,168 - 54,539,026 (-)	NCBI

RefSeq Acc Id:

XM_039086586 ⟹ XP_038942514

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,035,892 - 55,037,790 (-)	NCBI
mRatBN7.2	10	54,537,874 - 54,539,003 (-)	NCBI

RefSeq Acc Id:

XM_063269626 ⟹ XP_063125696

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,035,892 - 55,037,560 (-)	NCBI

RefSeq Acc Id:

XM_063269628 ⟹ XP_063125698

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,035,892 - 55,037,775 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001017475	(Get FASTA)	NCBI Sequence Viewer
	XP_038942511	(Get FASTA)	NCBI Sequence Viewer
	XP_038942512	(Get FASTA)	NCBI Sequence Viewer
	XP_038942514	(Get FASTA)	NCBI Sequence Viewer
	XP_063125696	(Get FASTA)	NCBI Sequence Viewer
	XP_063125698	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79298	(Get FASTA)	NCBI Sequence Viewer
	EDM04895	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071516.2
	ENSRNOP00000075824
	ENSRNOP00000075824.2
	ENSRNOP00055041415
	ENSRNOP00060045806
	ENSRNOP00065041651
GenBank Protein	Q68FV4	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001017475 ⟸ NM_001017475

- UniProtKB:

Q68FV4 (UniProtKB/Swiss-Prot), A6HFU0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MENQLWQSTLGCCSQYQESPQDAENILFLLLGLIILVNISINVTTVIWHGLQNAIDKMFSRMHQ
KTAEVQVTECPPKEPQPANVQDVHIHCVLDPVQVKMAQPTQCSSSSTHYFRKHSNDRRSRRRYC
YPRGSLQIRQSNQQQSCHSRQQRLRNNRQFSHGYPPFRKQRQSHKASQTRPMPFFDLEDRDSLL
EDDQSCPHPKQPRRSRGGLYKPVRLASNAGLWGRQGGILASLPLPSLYLSPEMRRLPKRVEAKS
ELRLQGFGPHYSQSRICGNVEAEQWASSPPPPRRLLPNPSWVTVGYSPFPSGGHIPYDARDQWR
RGTEGCEPPPAFVSRNLRSDAQGYRDHSSSQAHRQNFPSYTHSQPNHSPPQSVGYSSRESHEVR
RRAPDWSEAFPSRHPLTTSTSLTALGEASYQRAPTASSGLVIPHSSQRLAEGQISDPTPPATTF
VPLSRNPGGNANYQVYDSLELKRQVQENRGRASSLPPPSTSASRPSLHRSRTGKLN

hide sequence

RefSeq Acc Id:

ENSRNOP00000075824 ⟸ ENSRNOT00000092506

RefSeq Acc Id:

ENSRNOP00000071516 ⟸ ENSRNOT00000084068

RefSeq Acc Id:	XP_038942512 ⟸ XM_039086584
- Peptide Label:	isoform X2
- UniProtKB:	A6HFU0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038942511 ⟸ XM_039086583
- Peptide Label:	isoform X1
- UniProtKB:	A6HFU0 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038942514 ⟸ XM_039086586
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063125698 ⟸ XM_063269628
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_063125696 ⟸ XM_063269626
- Peptide Label:	isoform X3

Protein Domains

Spermatid maturation protein 1 N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q68FV4-F1-model_v2	AlphaFold	Q68FV4	1-504	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697325

Promoter ID:

EPDNEW_R7850

Type:

multiple initiation site

Name:

LOC497938_1

Description:

similar to RIKEN cDNA 4933402P03

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	56,426,074 - 56,426,134	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565061	AgrOrtholog
BioCyc Gene	G2FUF-24513	BioCyc
Ensembl Genes	ENSRNOG00000058939	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055029066	UniProtKB/Swiss-Prot
	ENSRNOG00060031932	UniProtKB/Swiss-Prot
	ENSRNOG00065029338	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000084068.2	UniProtKB/TrEMBL
	ENSRNOT00000092506	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOT00000092506.2	UniProtKB/Swiss-Prot
	ENSRNOT00055050330	UniProtKB/Swiss-Prot
	ENSRNOT00060055362	UniProtKB/Swiss-Prot
	ENSRNOT00065050677	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7134515	IMAGE-MGC_LOAD
InterPro	SPEM1_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:497938	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94435	IMAGE-MGC_LOAD
NCBI Gene	497938	ENTREZGENE
PANTHER	SPEM FAMILY MEMBER 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SPERMATID MATURATION PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Spem1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Spem2	PhenoGen
RatGTEx	ENSRNOG00000058939	RatGTEx
	ENSRNOG00055029066	RatGTEx
	ENSRNOG00060031932	RatGTEx
	ENSRNOG00065029338	RatGTEx
UniProt	A0A0U1RRV3_RAT	UniProtKB/TrEMBL
	A0A8L2R610_RAT	UniProtKB/TrEMBL
	A6HFU0	ENTREZGENE, UniProtKB/TrEMBL
	Q68FV4	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-09-05	Spem2	SPEM family member 2	LOC497938	similar to RIKEN cDNA 4933402P03	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC497938	similar to RIKEN cDNA 4933402P03			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar