Advanced Search (OLGA)

Gene: Efcab11 (EF-hand calcium binding domain 11) Rattus norvegicus

Analyze

Symbol:

Efcab11

Name:

EF-hand calcium binding domain 11

RGD ID:

1565006

Description:

Predicted to enable calcium ion binding activity and enzyme regulator activity. Predicted to be involved in microtubule cytoskeleton organization. Predicted to be active in cytoplasm. Orthologous to human EFCAB11 (EF-hand calcium binding domain 11); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

EF-hand calcium-binding domain-containing protein 11; EF-hand domain-containing protein C14orf143 homolog; LOC500705; similar to chromosome 14 open reading frame 143

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	EFCAB11 (EF-hand calcium binding domain 11)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther, PhylomeDB
Mus musculus (house mouse):	Efcab11 (EF-hand calcium binding domain 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Efcab11 (EF-hand calcium binding domain 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	EFCAB11 (EF-hand calcium binding domain 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	EFCAB11 (EF-hand calcium binding domain 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Efcab11 (EF-hand calcium binding domain 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	EFCAB11 (EF-hand calcium binding domain 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	EFCAB11 (EF-hand calcium binding domain 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Efcab11 (EF-hand calcium binding domain 11)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	EFCAB11 (EF-hand calcium binding domain 11)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Efcab11 (EF-hand calcium binding domain 11)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	efcab11 (EF-hand calcium binding domain 11)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	efcab11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	efcab11	Alliance	DIOPT (OMA\|OrthoFinder)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	124,738,531 - 124,892,623 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	124,738,542 - 124,891,675 (-)	Ensembl				GRCr8
mRatBN7.2	6	119,008,908 - 119,162,994 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	119,008,919 - 119,162,046 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	119,155,004 - 119,313,090 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	119,451,823 - 119,609,895 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	118,786,680 - 118,944,754 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	123,742,971 - 123,894,714 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	123,743,064 - 123,894,826 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	132,968,485 - 133,119,982 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	123,936,251 - 124,094,113 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	116,542,993 - 116,695,699 (-)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1-naphthyl isothiocyanate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

azathioprine (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

epoxiconazole (ISO)

fulvestrant (ISO)

lidocaine (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

Moniliformin (ISO)

N-Nitrosopyrrolidine (ISO)

O-methyleugenol (ISO)

ozone (ISO)

paracetamol (ISO)

PCB138 (ISO)

pentanal (ISO)

propanal (ISO)

quercetin (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

temozolomide (ISO)

trovafloxacin (ISO)

tungsten (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

microtubule cytoskeleton organization (IBA)

Cellular Component

cytoplasm (IBA)

Molecular Function

calcium ion binding (IBA,IEA)

enzyme regulator activity (IBA)

metal ion binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:26192016	PMID:31904090

Genomics

Comparative Map Data

Efcab11
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	124,738,531 - 124,892,623 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	6	124,738,542 - 124,891,675 (-)	Ensembl				GRCr8
mRatBN7.2	6	119,008,908 - 119,162,994 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	119,008,919 - 119,162,046 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	6	119,155,004 - 119,313,090 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	119,451,823 - 119,609,895 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	118,786,680 - 118,944,754 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	123,742,971 - 123,894,714 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	123,743,064 - 123,894,826 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	6	132,968,485 - 133,119,982 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	6	123,936,251 - 124,094,113 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	6	116,542,993 - 116,695,699 (-)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

EFCAB11
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	89,794,669 - 89,954,777 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	89,794,669 - 89,954,777 (-)	Ensembl			hg38	GRCh38
GRCh37	14	90,261,013 - 90,421,121 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	89,333,222 - 89,490,842 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	89,331,093 - 89,490,786	NCBI
Celera	14	70,310,740 - 70,468,290 (-)	NCBI		Celera
Cytogenetic Map	14	q32.11	NCBI
HuRef	14	70,437,426 - 70,595,017 (-)	NCBI		HuRef
CHM1_1	14	90,201,442 - 90,358,992 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	84,018,846 - 84,178,973 (-)	NCBI		T2T-CHM13v2.0

Efcab11
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	99,683,790 - 99,849,701 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	99,659,304 - 99,850,698 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	12	99,692,195 - 99,884,442 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	99,693,045 - 99,884,439 (-)	Ensembl			mm10	GRCm38
MGSCv37	12	100,955,741 - 101,121,652 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	12	100,118,581 - 100,284,492 (-)	NCBI		MGSCv36	mm8
Celera	12	100,940,390 - 101,105,944 (-)	NCBI		Celera
Cytogenetic Map	12	E	NCBI
cM Map	12	50.25	NCBI

Efcab11
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955438	12,267,722 - 12,420,869 (-)	Ensembl
ChiLan1.0	NW_004955438	12,269,610 - 12,420,775 (-)	NCBI	ChiLan1.0	ChiLan1.0

EFCAB11
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	90,933,594 - 91,099,591 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	90,159,438 - 90,316,097 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	70,414,351 - 70,573,039 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	89,766,772 - 89,925,341 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	89,769,013 - 89,925,224 (-)	Ensembl			panPan2	panpan1.1

EFCAB11
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	60,876,210 - 61,021,581 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	60,876,646 - 61,023,977 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	60,456,854 - 60,601,254 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	61,148,335 - 61,293,327 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	61,148,767 - 61,295,778 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	60,830,096 - 60,975,099 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	60,878,814 - 61,023,887 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	61,206,729 - 61,351,908 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Efcab11
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	14,840,745 - 14,994,771 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936488	17,074,126 - 17,228,263 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936488	17,075,493 - 17,228,234 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EFCAB11
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	111,600,717 - 111,766,205 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	111,574,771 - 111,766,267 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	118,137,693 - 118,330,930 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EFCAB11
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	67,507,804 - 67,672,991 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	67,507,047 - 67,671,627 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666053	54,817,472 - 54,975,455 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Efcab11
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	12,416,030 - 12,601,310 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624734	12,414,914 - 12,601,221 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Efcab11
887 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	103
Count of miRNA genes:	90
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000005082
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4145118	Mcs26	Mammary carcinoma susceptibility QTL 26		0.0001	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	112483610	147156653	Rat
1331797	Bp213	Blood pressure QTL 213	3.291		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	114241077	147156653	Rat
2293088	Iddm28	Insulin dependent diabetes mellitus QTL 28	5.21		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	68767270	135411972	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	88019181	136741135	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	90871046	135871046	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	93560258	136550638	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	98944780	143944780	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	100704576	136029228	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	110921244	147156653	Rat
724524	Uae2	Urinary albumin excretion QTL 2	2.7	0.0005	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	79198463	144254945	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	106095977	147156653	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	93778632	138778632	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	84490437	129490437	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	90871046	135871046	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	93560258	136550638	Rat
737976	Pia24	Pristane induced arthritis QTL 24			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	6	118366855	147156653	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	101593607	138161926	Rat
1298087	Iddm18	Insulin dependent diabetes mellitus QTL 18		0.0001	urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	6	122236101	147156653	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	93560258	136550638	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	99437079	125323237	Rat
12801471	Schws9	Schwannoma susceptibility QTL 9			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	101593607	146593607	Rat
2293085	Iddm29	Insulin dependent diabetes mellitus QTL 29	7.66		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	121444670	147156653	Rat

Markers in Region

RH139421

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	119,132,262 - 119,132,388 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	123,865,009 - 123,865,134	NCBI	Rnor6.0
Rnor_5.0	6	133,089,852 - 133,089,977	UniSTS	Rnor5.0
RGSC_v3.4	6	124,060,522 - 124,060,647	UniSTS	RGSC3.4
Celera	6	116,666,457 - 116,666,582	UniSTS
Cytogenetic Map	6	q32	UniSTS

RH142907

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	119,132,266 - 119,132,411 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	123,865,013 - 123,865,157	NCBI	Rnor6.0
Rnor_5.0	6	133,089,856 - 133,090,000	UniSTS	Rnor5.0
RGSC_v3.4	6	124,060,526 - 124,060,670	UniSTS	RGSC3.4
Celera	6	116,666,461 - 116,666,605	UniSTS
RH 3.4 Map	6	871.2	UniSTS
Cytogenetic Map	6	q32	UniSTS

RH138663

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	119,009,110 - 119,009,331 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	123,743,174 - 123,743,394	NCBI	Rnor6.0
Rnor_5.0	6	132,968,688 - 132,968,908	UniSTS	Rnor5.0
RGSC_v3.4	6	123,936,454 - 123,936,674	UniSTS	RGSC3.4
Celera	6	116,543,196 - 116,543,416	UniSTS
RH 3.4 Map	6	873.0	UniSTS
Cytogenetic Map	6	q32	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	8	60	153	77	76	45	49	45	6	274	140	11	132	68	87	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001024350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112741	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039112743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000082444 ⟹ ENSRNOP00000069648

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	6	124,738,542 - 124,891,675 (-)	Ensembl
mRatBN7.2 Ensembl	6	119,008,919 - 119,162,046 (-)	Ensembl
Rnor_6.0 Ensembl	6	123,743,064 - 123,894,826 (-)	Ensembl

RefSeq Acc Id:

NM_001024350 ⟹ NP_001019521

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	124,738,531 - 124,891,675 (-)	NCBI
mRatBN7.2	6	119,008,908 - 119,162,046 (-)	NCBI
Rnor_6.0	6	123,742,971 - 123,894,714 (-)	NCBI
Rnor_5.0	6	132,968,485 - 133,119,982 (-)	NCBI
RGSC_v3.4	6	123,936,251 - 124,094,113 (-)	RGD
Celera	6	116,542,993 - 116,695,699 (-)	RGD

Sequence:

show sequence

GGCCGCAGTGGCTGTTCTCGCTGGAGCGAAGGAGCTTCCCTGGCTTGGTCTTGGTGTCGGTGGG
GATGTTCCTGTCAGAGGCAGGCGCCAGGCCGCGAGCAGGCGAAATCAGCGCCTCAGAACGCAGG
AAATGGGTGGAAGTATTTAAAGCATGTGATGAAGACAACAAAGGCTACTTAAGCCGGGAAGACT
TTAAGGTTGCGATTGTAATGCTGTTTGGGTACAAACCCTCCAAGATAGAAGCGGATGCTGTGAT
GTCCTCAGCAAATCCCGACACTTCTGGTGTATCACTTGAGGGGTTTTTAAATGTCGTACAGAGA
AAGAAGGAGGCGCAGCTCTATCGGAATGAGATAAGGCACATCTTCACAGCATTCGACGTGCACT
ATCGTGGATTTTTAACTCTAGAAGATTTCAAAAGGGCGTTTAGTCAAGTGGCTCCCAAGCTGCC
GTCGAGGACAGTGCTGGAGGTGTTCAGGGAGGCAGATCAAGACTCAGATGGTCACGTCAGCTTC
CGAGACTTTGAATACGCCATGAACCATGGGAAAGCAAAATGAGCCAGGCCGGACACTTGTGAAC
TACTTCTGGAGAACCTGTGCAGATGGATGAACTGTAATCTAGTAATCACACAGACCACACTCTA
GGAAGGGCATGACACTGTGTACTTGTGCGTTAACTCTTAGCTATAGGTTTGGAATGTTGATATT
GGACCTAGAGGTGGGACTCTCCTTCTGTGTCTCTACCAGCCCAGTGGGTTTCGGGGGGTTTTCC
CTTCCTACTCTAGTCAGCTCTGCCTCCTCCACACTGTGAGTTGAAGGCTCTGCTCACTCCACAT
GGGTCCCTCGCTCTCATCAGCTCCGGGGAGGGTTCGCTTTGCTCTGCTAGTGGTGTCACTGCCA
TTCACTTGCTCCACCTTGGCTGAAGGTCAAGCTTCCTGAGTCCAAGCCATGAGCCAGTGCTGGG
AAAACAGAGACTTCCTCAGACAATGTCCCCGGAGTAGCGATCGGTGCACAGGGCACCAGTGTGC
ACAGCATAGGAAGCAGCTCGTGTGGGCGCCAGCATTCTTCATACAGAGAAGGCCAGAATGCAGT
TGGGGTCTTAATGGGCAGAAGGGTGTGATTTTTGGGTCCCTTTAGCATAGCCTGGGCCTGAGCC
TGGGCTTCTTCCTTCAGAGCAGCCGGCTGGAGAAGCGGGCCAGCAGCCCTCTGCTGCATACTTC
CAGTTCTGGGTAGTTTTGCCGAGTACCTGGAGATTCAGCCATCCTAGGGTTAGGAGGCTCTACA
TCCCGCCATGCCCCAGCGCGCCGGTGACTACCTTCCCGGACCTCATGGAGGCACAACATAGCAT
CTACTAAAAAGAATTCTGAAATACTGATATTATCACTGTAAGTGTTTCACAACATTAACATTTG
TAAAATAATTAATGTAATTTATGTCTCTAAAGTGTTAAACATTAAAAGATCAAGTAAAAATATA
AAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039112741 ⟹ XP_038968669

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	124,738,531 - 124,892,623 (-)	NCBI
mRatBN7.2	6	119,008,908 - 119,162,994 (-)	NCBI

RefSeq Acc Id:

XM_039112742 ⟹ XP_038968670

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	124,738,531 - 124,891,674 (-)	NCBI
mRatBN7.2	6	119,008,908 - 119,162,102 (-)	NCBI

RefSeq Acc Id:

XM_039112743 ⟹ XP_038968671

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	124,738,531 - 124,891,552 (-)	NCBI
mRatBN7.2	6	119,008,908 - 119,161,931 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001019521	(Get FASTA)	NCBI Sequence Viewer
	XP_038968669	(Get FASTA)	NCBI Sequence Viewer
	XP_038968670	(Get FASTA)	NCBI Sequence Viewer
	XP_038968671	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79408	(Get FASTA)	NCBI Sequence Viewer
	EDL81706	(Get FASTA)	NCBI Sequence Viewer
	EDL81707	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000069648
	ENSRNOP00000069648.1
GenBank Protein	Q6AXQ2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001019521 ⟸ NM_001024350
- UniProtKB:	Q6AXQ2 (UniProtKB/Swiss-Prot), A6JEG3 (UniProtKB/TrEMBL), A6JEG2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MFLSEAGARPRAGEISASERRKWVEVFKACDEDNKGYLSREDFKVAIVMLFGYKPSKIEADAVM SSANPDTSGVSLEGFLNVVQRKKEAQLYRNEIRHIFTAFDVHYRGFLTLEDFKRAFSQVAPKLP SRTVLEVFREADQDSDGHVSFRDFEYAMNHGKAK hide sequence

Ensembl Acc Id:

ENSRNOP00000069648 ⟸ ENSRNOT00000082444

RefSeq Acc Id:	XP_038968669 ⟸ XM_039112741
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038968670 ⟸ XM_039112742
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038968671 ⟸ XM_039112743
- Peptide Label:	isoform X2

Protein Domains

EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AXQ2-F1-model_v2	AlphaFold	Q6AXQ2	1-162	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565006	AgrOrtholog
BioCyc Gene	G2FUF-36511	BioCyc
Ensembl Genes	ENSRNOG00000053317	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000082444	ENTREZGENE
	ENSRNOT00000082444.2	UniProtKB/Swiss-Prot
Gene3D-CATH	EF-hand	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7113005	IMAGE-MGC_LOAD
InterPro	Calmodulin_Centrin_Ca-Bind	UniProtKB/Swiss-Prot
	EF-hand-dom_pair	UniProtKB/Swiss-Prot
	EF_Hand_1_Ca_BS	UniProtKB/Swiss-Prot
	EF_hand_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:500705	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94945	IMAGE-MGC_LOAD
NCBI Gene	500705	ENTREZGENE
PANTHER	CALCIUM BINDING PROTEIN	UniProtKB/Swiss-Prot
Pfam	EF-hand_7	UniProtKB/Swiss-Prot
	EF-hand_8	UniProtKB/Swiss-Prot
PhenoGen	Efcab11	PhenoGen
PROSITE	EF_HAND_1	UniProtKB/Swiss-Prot
	EF_HAND_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000053317	RatGTEx
SMART	EFh	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF47473	UniProtKB/Swiss-Prot
UniProt	A6JEG2	ENTREZGENE, UniProtKB/TrEMBL
	A6JEG3	ENTREZGENE, UniProtKB/TrEMBL
	EFC11_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-05-27	Efcab11	EF-hand calcium binding domain 11	LOC500705	similar to chromosome 14 open reading frame 143	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC500705	similar to chromosome 14 open reading frame 143			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message