Advanced Search (OLGA)

Gene: Acrbp (acrosin binding protein) Rattus norvegicus

Analyze

Symbol:

Acrbp

Name:

acrosin binding protein

RGD ID:

1564880

Description:

Predicted to be involved in acrosome assembly and fertilization. Predicted to be located in acrosomal membrane and extracellular region. Predicted to be active in acrosomal vesicle. Orthologous to human ACRBP (acrosin binding protein); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

acrosin-binding protein; acrosin-binding protein, 60 kDa form; proacrosin binding protein; proacrosin-binding protein sp32

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ACRBP (acrosin binding protein)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Acrbp (proacrosin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Acrbp (acrosin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ACRBP (acrosin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ACRBP (acrosin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Acrbp (acrosin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ACRBP (acrosin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ACRBP (acrosin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Acrbp (acrosin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Acrbp (acrosin binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ACRBP (acrosin binding protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Acrbp (proacrosin binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	acrbp.1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	acrbpl	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	acrbpl.2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	acrbpl.3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	159,537,395 - 159,550,454 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	159,537,391 - 159,550,454 (+)	Ensembl				GRCr8
mRatBN7.2	4	157,851,149 - 157,864,211 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	157,841,841 - 157,864,213 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	164,080,193 - 164,093,324 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	159,863,111 - 159,876,242 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	158,499,403 - 158,512,518 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	157,563,990 - 157,577,045 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	157,563,990 - 157,568,023 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	224,581,291 - 224,594,883 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	161,170,240 - 161,174,274 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	146,588,107 - 146,592,141 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain Neoplasms (ISO)

juvenile rheumatoid arthritis (ISO)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

copper atom (EXP)

copper(0) (EXP)

D-glucose (ISO)

Dibutyl phosphate (ISO)

diethylstilbestrol (ISO)

dimethylarsinic acid (ISO)

dorsomorphin (ISO)

erastin (ISO)

estriol (ISO)

fulvestrant (ISO)

furan (EXP)

gentamycin (EXP)

glucose (ISO)

indometacin (ISO)

methamphetamine (ISO)

methylarsonic acid (ISO)

methylmercury chloride (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (ISO)

PCB138 (ISO)

perfluorooctanoic acid (EXP)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

Soman (EXP)

tamoxifen (ISO)

tetrachloromethane (EXP)

tetraphene (ISO)

Theaflavin 3,3'-digallate (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

trovafloxacin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acrosome assembly (IEA,ISO,ISS)

fertilization (IEA,ISO,ISS)

spermatid development (IEA,ISO,ISS)

Cellular Component

acrosomal membrane (ISO,ISS)

acrosomal vesicle (IBA,IEA,ISO,ISS)

cytoplasmic vesicle (IEA)

extracellular region (ISO,ISS)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:8144514	PMID:15489334	PMID:15955892	PMID:21630459	PMID:22357636	PMID:23426433	PMID:27303034

Genomics

Comparative Map Data

Acrbp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	159,537,395 - 159,550,454 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	159,537,391 - 159,550,454 (+)	Ensembl				GRCr8
mRatBN7.2	4	157,851,149 - 157,864,211 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	157,841,841 - 157,864,213 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	164,080,193 - 164,093,324 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	159,863,111 - 159,876,242 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	158,499,403 - 158,512,518 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	157,563,990 - 157,577,045 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	157,563,990 - 157,568,023 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	224,581,291 - 224,594,883 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	161,170,240 - 161,174,274 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	146,588,107 - 146,592,141 (+)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

ACRBP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	6,638,075 - 6,647,432 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	6,638,075 - 6,647,433 (-)	Ensembl			hg38	GRCh38
GRCh37	12	6,747,241 - 6,756,598 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	6,617,503 - 6,626,841 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	12	6,617,502 - 6,626,841	NCBI
Celera	12	8,364,217 - 8,373,557 (-)	NCBI		Celera
Cytogenetic Map	12	p13.31	NCBI
HuRef	12	6,600,543 - 6,609,883 (-)	NCBI		HuRef
CHM1_1	12	6,746,238 - 6,755,578 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	6,648,439 - 6,657,798 (-)	NCBI		T2T-CHM13v2.0

Acrbp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	125,026,890 - 125,040,228 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	125,026,652 - 125,040,230 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	125,049,927 - 125,063,265 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	125,049,689 - 125,063,267 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	124,999,945 - 125,013,283 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	125,015,594 - 125,028,862 (+)	NCBI		MGSCv36	mm8
Celera	6	126,719,643 - 126,732,965 (+)	NCBI		Celera
Cytogenetic Map	6	F2	NCBI
cM Map	6	59.17	NCBI

Acrbp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955413	4,251,608 - 4,262,095 (-)	NCBI	ChiLan1.0	ChiLan1.0

ACRBP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	12,199,893 - 12,210,628 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	12,196,651 - 12,207,398 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	6,768,971 - 6,778,613 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	6,685,963 - 6,695,344 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	6,685,963 - 6,695,344 (-)	Ensembl			panPan2	panpan1.1

ACRBP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	38,380,244 - 38,388,502 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	38,380,363 - 38,388,496 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	8,227,951 - 8,236,209 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	38,736,524 - 38,743,234 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	38,734,870 - 38,743,228 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	38,607,051 - 38,615,309 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	38,648,579 - 38,656,840 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	7,706,633 - 7,715,103 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Acrbp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	102,480,845 - 102,490,190 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936709	1,148,454 - 1,158,069 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACRBP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	64,037,095 - 64,047,847 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	5	64,036,810 - 64,047,846 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	66,530,446 - 66,541,094 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ACRBP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	6,672,093 - 6,681,493 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	6,672,312 - 6,681,198 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666063	1,544,427 - 1,553,723 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Acrbp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624860	3,338,690 - 3,352,396 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624860	3,338,478 - 3,353,373 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Acrbp
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	22,832,155 - 22,846,243 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Acrbp
106 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	42
Interacting mature miRNAs:	46
Transcripts:	ENSRNOT00000024618
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	146370897	184426481	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	134095016	179095016	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	149763204	169799698	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	146370897	184426481	Rat
6478757	Anxrr44	Anxiety related response QTL 44		0.01087	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
1358364	Sradr4	Stress Responsive Adrenal Weight QTL 4	4.92		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	4	131384565	176384565	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	123870974	168870974	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	117559384	162559384	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	140059299	181024663	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	157292416	184426481	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	106848959	168870974	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	127263297	172263297	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	126334185	171334185	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	147299608	184426481	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
6478782	Anxrr52	Anxiety related response QTL 52		0.02091	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	124700988	169700988	Rat
6478720	Alc23	Alcohol consumption QTL 23		0.00509	drinking behavior trait (VT:0001422)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	155834926	184426481	Rat
6478785	Anxrr53	Anxiety related response QTL 53		0.01397	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
1581566	Eae21	Experimental allergic encephalomyelitis QTL 21	6.2		body mass (VT:0001259)	maximum body weight loss to initial body weight ratio (CMO:0001400)	4	137447185	182447185	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	137430611	182430611	Rat
6478728	Anxrr36	Anxiety related response QTL 36		0.01061	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	134199006	168870974	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	148121375	176967367	Rat
6478733	Anxrr37	Anxiety related response QTL 37		0.00095	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	123870974	168870974	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	140059299	184426481	Rat
6478737	Anxrr38	Anxiety related response QTL 38		0.00159	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	155834926	184426481	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	116184844	161184844	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	146370897	184426481	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	148834094	168870974	Rat

Markers in Region

RH127593

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	157,850,174 - 157,850,371 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	157,563,009 - 157,563,205	NCBI	Rnor6.0
Rnor_5.0	4	224,580,847 - 224,581,043	UniSTS	Rnor5.0
RGSC_v3.4	4	161,169,259 - 161,169,455	UniSTS	RGSC3.4
Celera	4	146,587,126 - 146,587,322	UniSTS
RH 3.4 Map	4	997.6	UniSTS
Cytogenetic Map	4	q42	UniSTS

RH136757

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	157,855,052 - 157,855,172 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	157,567,887 - 157,568,006	NCBI	Rnor6.0
Rnor_5.0	4	224,585,725 - 224,585,844	UniSTS	Rnor5.0
RGSC_v3.4	4	161,174,137 - 161,174,256	UniSTS	RGSC3.4
Celera	4	146,592,004 - 146,592,123	UniSTS
Cytogenetic Map	4	q42	UniSTS

AU046982

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	157,854,700 - 157,855,312 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	157,567,535 - 157,568,146	NCBI	Rnor6.0
Rnor_6.0	13	18,370,226 - 18,370,317	NCBI	Rnor6.0
Rnor_5.0	4	224,585,372 - 224,585,984	NCBI	Rnor5.0
Rnor_5.0	13	23,575,622 - 23,575,714	NCBI	Rnor5.0
RGSC_v3.4	4	161,173,785 - 161,174,396	UniSTS	RGSC3.4
RGSC_v3.4	13	4,625,682 - 4,625,773	UniSTS	RGSC3.4
Celera	13	15,125,914 - 15,126,005	UniSTS
Celera	4	146,591,652 - 146,592,263	UniSTS
Cytogenetic Map	4	q42	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	160	91	90	59	91	59	6	355	191	11	139	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001401824	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005503305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC115415	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC079212	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024618 ⟹ ENSRNOP00000024618

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	159,537,400 - 159,550,454 (+)	Ensembl
mRatBN7.2 Ensembl	4	157,851,156 - 157,864,213 (+)	Ensembl
Rnor_6.0 Ensembl	4	157,563,990 - 157,568,023 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100465 ⟹ ENSRNOP00000089375

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	157,841,841 - 157,855,189 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107135 ⟹ ENSRNOP00000081228

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	159,537,391 - 159,539,119 (+)	Ensembl
mRatBN7.2 Ensembl	4	157,851,156 - 157,852,876 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000167907 ⟹ ENSRNOP00000100112

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	159,537,606 - 159,550,453 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000171833 ⟹ ENSRNOP00000105555

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	159,537,425 - 159,550,453 (+)	Ensembl

RefSeq Acc Id:

NM_001025049 ⟹ NP_001020220

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	159,537,399 - 159,541,433 (+)	NCBI
mRatBN7.2	4	157,851,156 - 157,855,190 (+)	NCBI
Rnor_6.0	4	157,563,990 - 157,568,024 (+)	NCBI
Rnor_5.0	4	224,581,291 - 224,594,883 (+)	NCBI
RGSC_v3.4	4	161,170,240 - 161,174,274 (+)	RGD
Celera	4	146,588,107 - 146,592,141 (+)	RGD

Sequence:

show sequence

CTTCGCGCTAGCAACCCGAGACCCACGATCTCCGAGGCTTAGCCCGTTGGAGGTCGCTTTGTTG
TGAAAACGCGGGAGGATCTTACCAAGACGTGATGAAACTAGCTGCTAGCTTCCTTCTGATGCTT
CTGGAAGTGCTGCTCCTGCCTGAAACACCTCTTTCAGCTGAGGAAGCTTTAGCCTCCACTCCAG
GCAGCCCTCTCTCATCCACTGAATATGAACGTTTCTTCGCCCTGCTGACCCCAACCTGGAAGGC
AGAGACCACCTGCCGCCTCCGTGCAACCCACGGCTGCCGGAACCCCACTCTCGTTCAGCTGGAT
CAATATGAAAACCACGGATTGGTACCAGATGGTGCTGTCTGCTCTGACCTACCCTATGCTTCCT
GGTTTGAGTCTTTCTGCCAGTTTGCTCAGTATCGTTGCTCCAACCATGTCTACTATGCCAAGAG
GGTCCGGTGCTCCCAGCCAGTCTCCATCCTTTCCCCCAACACTCTAAAGGAGGTGGAGTCCTCA
GCAGAAGTTCCTCTCACTTCCGTGACCACCCCCATTGTATCCCGTGCCACAGCCACGGAACACC
AGGCCTTCCAGCCTTGGCCCGAGCGGCTCAACAACAATGTGGAGGAGCTGCTCCAGTCGTCCTT
GTCCCTGGGAGGCAAGGAGCAACAGAGTAGTCGGAAGCTAGGCCTGGAGCAGCAGCACAAGCAG
GAGCAGATCCAAGAACACAAGCTAGAAGAAGCGCAGGAGCAGGAGGAGCAAGAGGAAGAGGAAG
AGGAGGAAGAGGCAAAGCAGGAAGAGGGGCAGGGGACAGAGGAGGGTCTGGATTCAGTGTCCAG
ACTGCAGTCAGACTCGGAGCCCAAGTTTCAGTCCAAGTCACTGTCTTCCAACCCTTCCTTCTTC
ACTCCCCGGGTCCGAGAGGTGGAGTCCGCTCCATTGATGATGGAGAACATCCAGGAGCTCATCC
GGTCCGCCCAAGAAATGGACGAAATGAACGAACTGTACGATGACTCCTGGAGAAGCCAAAGCAC
TGGCAGGTACAGGAAATTGTGACTTCTTCATGGGCCCTGCCATCCCTGCTGCCTCCTCTGGAAA
TGCGAAGCCCACTTACCAGCTTTGGTCTCCAGACCCACTCAGACCTGCTTAGGCTTCGAGCACA
GCTAGCAATGGCGGCCCTCCTGTTCTGTGCCCATCCTTGTTTTAAGCCTCACCCTGGGCTCTGG
TCTTACCTCTGGCCTTGATTAGCACTAAAGCCTTCAGAAAGTTAAAAAAAAAAAAAAAAAAAAA
AAAA

hide sequence

RefSeq Acc Id:

NM_001401824 ⟹ NP_001388753

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	159,537,400 - 159,550,454 (+)	NCBI
mRatBN7.2	4	157,851,157 - 157,864,211 (+)	NCBI

RefSeq Acc Id:

XR_005503305

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	159,537,395 - 159,548,187 (+)	NCBI
mRatBN7.2	4	157,851,149 - 157,861,933 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020220	(Get FASTA)	NCBI Sequence Viewer
	NP_001388753	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79212	(Get FASTA)	NCBI Sequence Viewer
	EDM01881	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024618
GenBank Protein	Q6AY33	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001020220 ⟸ NM_001025049
- Peptide Label:	isoform 1 precursor
- UniProtKB:	A0A8I6A9P9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKLAASFLLMLLEVLLLPETPLSAEEALASTPGSPLSSTEYERFFALLTPTWKAETTCRLRATH GCRNPTLVQLDQYENHGLVPDGAVCSDLPYASWFESFCQFAQYRCSNHVYYAKRVRCSQPVSIL SPNTLKEVESSAEVPLTSVTTPIVSRATATEHQAFQPWPERLNNNVEELLQSSLSLGGKEQQSS RKLGLEQQHKQEQIQEHKLEEAQEQEEQEEEEEEEEAKQEEGQGTEEGLDSVSRLQSDSEPKFQ SKSLSSNPSFFTPRVREVESAPLMMENIQELIRSAQEMDEMNELYDDSWRSQSTGRYRKL hide sequence

Ensembl Acc Id:

ENSRNOP00000024618 ⟸ ENSRNOT00000024618

Ensembl Acc Id:

ENSRNOP00000081228 ⟸ ENSRNOT00000107135

Ensembl Acc Id:

ENSRNOP00000089375 ⟸ ENSRNOT00000100465

RefSeq Acc Id:	NP_001388753 ⟸ NM_001401824
- Peptide Label:	isoform 2 precursor
- UniProtKB:	Q6AY33 (UniProtKB/Swiss-Prot), A6ILQ8 (UniProtKB/TrEMBL), A0A8L2QCS1 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000105555 ⟸ ENSRNOT00000171833

Ensembl Acc Id:

ENSRNOP00000100112 ⟸ ENSRNOT00000167907

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AY33-F1-model_v2	AlphaFold	Q6AY33	1-540	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693402

Promoter ID:

EPDNEW_R3927

Type:

initiation region

Name:

Acrbp_1

Description:

acrosin binding protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	157,563,981 - 157,564,041	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564880	AgrOrtholog
BioCyc Gene	G2FUF-43018	BioCyc
Ensembl Genes	ENSRNOG00000017399	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000024618	ENTREZGENE
IMAGE_CLONE	IMAGE:7131828	IMAGE-MGC_LOAD
InterPro	Proacrosin-bd	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94274	IMAGE-MGC_LOAD
NCBI Gene	500316	ENTREZGENE
PANTHER	ACROSIN-BINDING PROTEIN	UniProtKB/Swiss-Prot
	PTHR21362	UniProtKB/Swiss-Prot
Pfam	PBP_sp32	UniProtKB/Swiss-Prot
PhenoGen	Acrbp	PhenoGen
RatGTEx	ENSRNOG00000017399	RatGTEx
UniProt	A0A8I5ZUM1_RAT	UniProtKB/TrEMBL
	A0A8I6A9P9	ENTREZGENE
	A0A8L2QCS1	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0KYH9_RAT	UniProtKB/TrEMBL
	A0ABK0LIN1_RAT	UniProtKB/TrEMBL
	A6ILQ8	ENTREZGENE, UniProtKB/TrEMBL
	ACRBP_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-08-29	Acrbp	acrosin binding protein	Acrbp	proacrosin binding protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-26	Acrbp	proacrosin binding protein	Acrbp	acrosin binding protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	Acrbp	acrosin binding protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD