Advanced Search (OLGA)

Gene: Cntd1 (cyclin N-terminal domain containing 1) Rattus norvegicus

Analyze

Symbol:

Cntd1

Name:

cyclin N-terminal domain containing 1

RGD ID:

1564542

Description:

Orthologous to human CNTD1 (cyclin N-terminal domain containing 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride; cadmium dichloride.

Type:

protein-coding

RefSeq Status:

INFERRED

Previously known as:

cyclin N-terminal domain-containing protein 1; LOC498001; RGD1564542; similar to Serine/threonine-protein kinase WNK4 (Protein kinase with no lysine 4) (Protein kinase, lysine-deficient 4) (Ac2-059); similar to Serine/threonine-protein kinase WNK4 (Protein kinase, lysine-deficient 4)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	86,721,692 - 86,732,074 (+)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	10	86,221,430 - 86,231,812 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	10	91,259,174 - 91,269,564 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	90,733,705 - 90,744,087 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	86,126,873 - 86,137,255 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	89,199,988 - 89,210,369 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	89,199,880 - 89,209,393 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	88,998,374 - 89,009,400 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	90,308,109 - 90,316,974 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	84,939,437 - 84,949,768 (+)	NCBI		Celera
Cytogenetic Map	10	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

ammonium chloride (EXP)

astaxanthin (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (ISO)

Bisphenol A diglycidyl ether (ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

cadmium dichloride (EXP,ISO)

CGP 52608 (ISO)

Dibutyl phosphate (ISO)

gentamycin (EXP)

glycidol (EXP)

okadaic acid (ISO)

ozone (ISO)

paracetamol (EXP)

pioglitazone (ISO)

resveratrol (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

reciprocal meiotic recombination (ISO)

regulation of meiotic cell cycle (ISO)

spermatogenesis (ISO)

Cellular Component

chromosome (ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:16751776	PMID:24891606

Genomics

Comparative Map Data

Cntd1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	86,721,692 - 86,732,074 (+)	NCBI	GRCr8	GRCr8		GRCr8
mRatBN7.2	10	86,221,430 - 86,231,812 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	10	91,259,174 - 91,269,564 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	90,733,705 - 90,744,087 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	86,126,873 - 86,137,255 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	89,199,988 - 89,210,369 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	89,199,880 - 89,209,393 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	88,998,374 - 89,009,400 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	90,308,109 - 90,316,974 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	84,939,437 - 84,949,768 (+)	NCBI		Celera
Cytogenetic Map	10	q31	NCBI

CNTD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	42,798,785 - 42,811,587 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	42,798,800 - 42,811,587 (+)	Ensembl			hg38	GRCh38
GRCh37	17	40,950,879 - 40,963,605 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	38,204,464 - 38,216,179 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	17	37,606,841 - 37,619,590 (+)	NCBI		Celera
Cytogenetic Map	17	q21.2-q21.31	NCBI
HuRef	17	36,715,242 - 36,727,994 (+)	NCBI		HuRef
CHM1_1	17	41,186,440 - 41,199,222 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	43,655,867 - 43,668,726 (+)	NCBI		T2T-CHM13v2.0

Cntd1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	101,170,029 - 101,179,527 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	101,169,838 - 101,187,143 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	101,279,203 - 101,288,701 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	101,279,012 - 101,296,317 (+)	Ensembl			mm10	GRCm38
MGSCv37	11	101,140,517 - 101,150,015 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	101,095,293 - 101,104,791 (+)	NCBI		MGSCv36	mm8
MGSCv36	11	102,058,288 - 102,067,873 (+)	NCBI		MGSCv36	mm8
Cytogenetic Map	11	D	NCBI
cM Map	11	64.56	NCBI

Cntd1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	16,608,934 - 16,616,086 (+)	Ensembl
ChiLan1.0	NW_004955451	16,608,810 - 16,617,095 (+)	NCBI	ChiLan1.0	ChiLan1.0

CNTD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	22,173,569 - 22,187,093 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	24,065,236 - 24,077,219 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	14,506,354 - 14,519,279 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	14,731,829 - 14,744,396 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	14,731,829 - 14,744,338 (-)	Ensembl			panPan2	panpan1.1

CNTD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	20,214,310 - 20,222,938 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	20,188,167 - 20,222,743 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	19,675,628 - 19,684,264 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	20,930,820 - 20,941,331 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	20,933,815 - 20,941,139 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	19,717,591 - 19,726,224 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	19,983,830 - 19,992,465 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	20,086,531 - 20,095,163 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cntd1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	19,557,743 - 19,565,579 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	17,509,619 - 17,517,396 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	17,509,619 - 17,517,396 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CNTD1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	20,053,516 - 20,062,708 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	20,054,572 - 20,062,754 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	20,268,434 - 20,277,711 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CNTD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	63,482,279 - 63,490,359 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666077	34,273,460 - 34,285,198 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cntd1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624795	1,406,954 - 1,414,432 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624795	1,403,809 - 1,414,524 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cntd1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	60,583,092 - 60,592,287 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cntd1
43 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	51071897	96071897	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
631555	Bp134	Blood pressure QTL 134		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	81012077	91729860	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	58073360	103073360	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	54296336	99451733	Rat
4889948	Bss91	Bone structure and strength QTL 91	4		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	10	83061236	92869129	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41831278	86831278	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76951790	107713808	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50464802	95464802	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	79272424	102982300	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	73599825	107713808	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45529164	96099749	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44939359	89939359	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
10450495	Bp383	Blood pressure QTL 383		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76743133	95464802	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50860288	95860288	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2292617	Ept18	Estrogen-induced pituitary tumorigenesis QTL 18	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73950353	96620293	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42823274	87823274	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	67241334	98502431	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44939359	89939359	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42823274	87823274	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61843496	98710773	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	73695339	97272278	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	81012077	101828297	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
2306793	Ean5	Experimental allergic neuritis QTL 5	4.7		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	73049656	94495280	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	49495492	94495492	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68920187	107713808	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70698731	107713808	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	55307972	93608131	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61843496	100198886	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	43608793	88608793	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49943710	94943710	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44939359	89939359	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61843496	100198886	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47869129	92869129	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
12880055	Am11	Aortic mass QTL 11		0.004	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	84503487	96432422	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76743133	95604677	Rat
2301398	Kidm38	Kidney mass QTL 38		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	84503487	96432422	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50604677	95604677	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	76128947	107713808	Rat
1358188	Ept9	Estrogen-induced pituitary tumorigenesis QTL 9	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73950353	96620293	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

RH127824

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	86,731,825 - 86,732,029 (+)	Marker Load Pipeline
mRatBN7.2	10	86,231,563 - 86,231,767 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	89,210,121 - 89,210,324	NCBI	Rnor6.0
Rnor_5.0	10	89,009,152 - 89,009,355	UniSTS	Rnor5.0
RGSC_v3.4	10	90,318,134 - 90,318,337	UniSTS	RGSC3.4
Celera	10	84,949,520 - 84,949,723	UniSTS
RH 3.4 Map	10	877.09	UniSTS
Cytogenetic Map	10	q32.1	UniSTS

RH129557

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	86,220,222 - 86,220,410 (+)	MAPPER	mRatBN7.2
mRatBN7.2	12	9,417,030 - 9,417,218 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	11,187,165 - 11,187,352	NCBI	Rnor6.0
Rnor_6.0	10	89,198,781 - 89,198,968	NCBI	Rnor6.0
Rnor_5.0	12	13,256,267 - 13,256,454	UniSTS	Rnor5.0
Rnor_5.0	10	88,997,167 - 88,997,354	UniSTS	Rnor5.0
RGSC_v3.4	10	90,306,793 - 90,306,980	UniSTS	RGSC3.4
RGSC_v3.4	12	9,730,616 - 9,730,803	UniSTS	RGSC3.4
Celera	12	11,222,163 - 11,222,350	UniSTS
Celera	10	84,938,230 - 84,938,417	UniSTS
Cytogenetic Map	10	q32.1	UniSTS
Cytogenetic Map	12	p11	UniSTS

RH134547

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	86,219,437 - 86,219,617 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	89,197,996 - 89,198,175	NCBI	Rnor6.0
Rnor_5.0	10	88,996,382 - 88,996,561	UniSTS	Rnor5.0
RGSC_v3.4	10	90,306,008 - 90,306,187	UniSTS	RGSC3.4
Celera	10	84,937,445 - 84,937,624	UniSTS
RH 3.4 Map	10	860.3	UniSTS
Cytogenetic Map	10	q32.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	59	146	79	78	47	81	47	6	324	172	11	125	81	89	31	15	15

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001197217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123346	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ606783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000076865 ⟹ ENSRNOP00000068472

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	10	89,199,880 - 89,209,393 (+)	Ensembl

RefSeq Acc Id:

NM_001197217 ⟹ NP_001184146

RefSeq Status:

INFERRED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	86,721,692 - 86,732,074 (+)	NCBI
mRatBN7.2	10	86,221,430 - 86,231,812 (+)	NCBI
Rnor_6.0	10	89,199,988 - 89,210,369 (+)	NCBI
Rnor_5.0	10	88,998,374 - 89,009,400 (+)	NCBI
Celera	10	84,939,437 - 84,949,768 (+)	NCBI

Sequence:

show sequence

AGGAAGGGAAGGAGGAATCCAAGGTGTGACAGAAGATTCTGGAAATAAGCTAAAGAAGCCAGTT
TATGGATCCCGTGAACTGTGCAAGTGCTCCGAAAGAGTTCTGAATATGGAAGGACCCTTGAGGC
CAAGACTGGTTAACTGCAGTGACTTTCAGTTTGGAGTGGTTGCCACAGAGACCATCGAAAATGC
TCTGCTTCACTTGGCCCAGCAGAATGAGCAAGCAGTGAAGGAGGCTGCCGGACGGTCAGGCAGC
TTCAGGGAGACCCGGATCGTTGAGTTTGTCTTTCTCCTGTCTGAACAATGGTGTCTGGAGAAAT
CGGTGAGCTACCAGGCCGTAGAAATCCTAGAAAGGTTTATGGTGAAGCAGGCAGAGAACATCTG
TCAGCAAGCCACACTCCAGCTGAGAAGTAACGAGCTGCAGAGCTGGAGGGCTCTGAAAGAGCAG
CTCTCCAACAAGTTTATCCTCCGTCTGGTGTCGTGTGTGCAGCTGGCCAGCAAACTGTCTTTCC
ACTACAAAATTGTCAGCAACATCACAGTCCTCAATTTCCTCCAGGCCCTTGGTTATGGATACAC
CAAAGAAGAGCTGCTAGAATCGGAGCTTGATATTTTGAAGTCCCTGAACTTCCAAATAAATCTG
CCCACACCGCTGGCATATGTGGAGATGCTCCTTGAAGTTCTAGGGTACAATGGCTGTTTGGTCC
CCGCCACACAACTACATGCAACGTGTCTGACCCTCCTCGACCTGGTCTATCTTCTGCACGAGCC
CATCTATGAGAGCCTCTTGAGAGCTTCAATCGAGAATTCTCCACCCAGTCAGCTGCAGGGGGAA
AAGTTTATCTCTGTGAAGGAAGACTTTATGCTGTTGGCAGTTGGCATCATTGCAGCGAGCGCCT
TCATCCAAAACCATGAATGCTGGAGCCAGGTCATAGGGCATTTGCAGAGCATCACGGGCATTGC
CTCGGAAAGCATTGCTGAGTTCTCTTACGCAATCCTGACTCACAGCGTGGGAGCAAACACCCCT
GGGCAACAGCACCCTGTTCCCCACAAGGCCGCCAGAGCTCTGAGGACTGCTGCTTCCTCTAACA
CATGAGGCTGGCTGAGCTGCACCACCTTCTGTCACTGAACCCCCTTCCTTGTTTACTTTCATAC
TCAGGGAACAAAAATTCCAAGTTTCCTTTGAACAGTGTTTTGTATTTCAATTTCAGGCATGTTA
TTTTTTTCTACATCAGAGATAGTTATGGGAGACAAACATATCTGTTGTGTCATGGTAGGCTAAA
AAAACATCAAAGAATTGGACCAGAGTTAGATTGTGAAATTGGTCCATTTTTGTTTGACAAGACT
TTTAAATTTTCCTAATTTAATCTAAGAGGTAATATCACATAGAAATAAGTATTTCTGAGGACTT
TAAAACACTTTTGGATGACCTTGACCAAGTGTCTCTGAGGTAGCCTTTCTTCCCTTGCTCCTGC
TACAGCTGGTTTTTTTGTTTTGCTTTGTTGTTTTAAAGATTTATTTATTTTATGTATATGAATG
CAGTGTTGCTCTCTTCAGACACACCAGAAGAGGGCATCAGATCCCATGTCAGATGGTTGTGAGC
CACCATGTGGTTGCTGGGAATTGAACTCAGGACCTCTGGAAGAGCAGCCAGTGCTCTTAACCAC
TGAGTCTCCAGCCCTTGTTTTGTTTGTTATTCCCACCCCCCCACTTTTGTTTTTTTTCTTTTTT
CTTTTTTTCGGAGCTGGGGACCGAACCCAGGGCCTTGCGCTTCCTAGGCAAGTGCTCTACCACT
GAGCTAAATCCCCAGCCCCCACTTTTGTTTTTTAAAGACAGGGTCTCACTATTCAGCCCTGGCT
GTCTTGCAGCTCACTGAATACACGAGACTAGGCTGGAATTCAGAGGTCCACTCGCCTTTGCTTC
CTGAGTGCTGGAGCTAAATACCCTCATTCTGGCTCTTTTTTTTTTTTAAGCTAAGACATGTTTC
AACAGAATCTCTACCGAACTGACTGAAACTCAGTTCTTCCAAAATACAAAATACTCAACTTTAA
GGAAAAACATCCTGGCGTACCACTTGGTAATTAATAGACCATAGCAAATCCTTTATTACAAATA
ATTAAATCCTTCCACATCTCAAACAGTATCAAACAGCATTTTGTAATTCCAATAGTTAGCACAG
TAAGCGTTCAATACTAGAAGTGAGGACAGAGTTAAACCTTTACCTCTTGTCCCTTCCCCACATT
ACCCAACTGTGTGCCACAAGCATCTCATCTCAAAACTTTTCTGTTTCAAGTACAGGAAGTTGAG
AGAGATAAAATCCAGTGAAAACACATTAATGTCAATTCAACTTAAAAAAGAAAACAAAGCAAAT
TTAAATTAGTTGTTTCCAGGGAAGAGGGAAAGGACAGCATGGGGTTGAGCCAAACTACGGCAGG
GCTCTTTGCTATACATGGCGTGCTGTGCTCTGAAAACTGTCATATTGTAAAATAAAGTAGCTTT
TGTGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001184146	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM06107	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001184146 ⟸ NM_001197217

- UniProtKB:

A0A096MKD3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEGPLRPRLVNCSDFQFGVVATETIENALLHLAQQNEQAVKEAAGRSGSFRETRIVEFVFLLSE
QWCLEKSVSYQAVEILERFMVKQAENICQQATLQLRSNELQSWRALKEQLSNKFILRLVSCVQL
ASKLSFHYKIVSNITVLNFLQALGYGYTKEELLESELDILKSLNFQINLPTPLAYVEMLLEVLG
YNGCLVPATQLHATCLTLLDLVYLLHEPIYESLLRASIENSPPSQLQGEKFISVKEDFMLLAVG
IIAASAFIQNHECWSQVIGHLQSITGIASESIAEFSYAILTHSVGANTPGQQHPVPHKAARALR
TAASSNT

hide sequence

Ensembl Acc Id:

ENSRNOP00000068472 ⟸ ENSRNOT00000076865

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A096MKD3-F1-model_v2	AlphaFold	A0A096MKD3	1-327	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697753

Promoter ID:

EPDNEW_R8276

Type:

initiation region

Name:

Cntd1_1

Description:

cyclin N-terminal domain containing 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	89,199,923 - 89,199,983	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1564542	AgrOrtholog
BioCyc Gene	G2FUF-23184	BioCyc
Ensembl Genes	ENSRNOG00000051150	Ensembl
NCBI Gene	498001	ENTREZGENE
PhenoGen	Cntd1	PhenoGen
RatGTEx	ENSRNOG00000051150	RatGTEx
UniProt	A0A096MKD3	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-06	Cntd1	cyclin N-terminal domain containing 1	RGD1564542_predicted	similar to Serine/threonine-protein kinase WNK4 (Protein kinase, lysine-deficient 4) (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-10	RGD1564542_predicted	similar to Serine/threonine-protein kinase WNK4 (Protein kinase, lysine-deficient 4) (predicted)		similar to Serine/threonine-protein kinase WNK4 (Protein kinase with no lysine 4) (Protein kinase, lysine-deficient 4) (Ac2-059) (predicted)	Name updated	1299863	APPROVED
2006-03-07	RGD1564542_predicted	similar to Serine/threonine-protein kinase WNK4 (Protein kinase with no lysine 4) (Protein kinase, lysine-deficient 4) (Ac2-059) (predicted)	LOC498001	similar to Serine/threonine-protein kinase WNK4 (Protein kinase with no lysine 4) (Protein kinase, lysine-deficient 4) (Ac2-059)	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC498001	similar to Serine/threonine-protein kinase WNK4 (Protein kinase with no lysine 4) (Protein kinase, lysine-deficient 4) (Ac2-059)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message