Advanced Search (OLGA)

Gene: Fcrl6 (Fc receptor-like 6) Rattus norvegicus

Analyze

Symbol:

Fcrl6

Name:

Fc receptor-like 6

RGD ID:

1563939

Description:

Predicted to enable MHC class II protein binding activity; protein phosphatase binding activity; and transmembrane signaling receptor activity. Predicted to be involved in cell surface receptor signaling pathway and immune response. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. Orthologous to human FCRL6 (Fc receptor like 6); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; amphetamine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cell surface glycoprotein gp42; Gp42; LOC305103

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FCRL6 (Fc receptor like 6)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Fcrl6 (Fc receptor-like 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fcrl6 (Fc receptor like 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100974844 (Fc receptor-like protein 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FCRL6 (Fc receptor like 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fcrl6 (Fc receptor like 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FCRL6 (Fc receptor like 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103223750 (Fc receptor-like protein 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fcrl6 (Fc receptor like 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Fcrl6 (Fc receptor like 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	FCRL2 (Fc receptor like 2)	HGNC	Panther
Alliance orthologs ³
Homo sapiens (human):	FCRL6 (Fc receptor like 6)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fcrl6 (Fc receptor-like 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fcrl6 (Fc receptor-like 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	87,595,058 - 87,604,657 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	87,595,058 - 87,604,949 (-)	Ensembl				GRCr8
mRatBN7.2	13	85,062,709 - 85,072,308 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	85,066,694 - 85,072,600 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	87,565,846 - 87,575,333 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	88,966,119 - 88,975,598 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	86,150,861 - 86,160,342 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	90,982,814 - 90,992,415 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	90,982,814 - 90,992,406 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	95,501,915 - 95,511,516 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	88,601,569 - 88,611,170 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	84,671,572 - 84,681,173 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

aflatoxin B1 (ISO)

amphetamine (EXP)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

Dibutyl phosphate (ISO)

diuron (ISO)

fenvalerate (EXP)

GSK-J4 (ISO)

lipopolysaccharide (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

Theaflavin 3,3'-digallate (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

tungsten (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell surface receptor signaling pathway (IBA)

immune response (IBA)

Cellular Component

external side of plasma membrane (IBA,ISO)

plasma membrane (IEA,ISO)

side of membrane (IEA)

Molecular Function

MHC class II protein binding (ISO)

phosphatase binding (ISO)

protein binding (ISO)

protein phosphatase binding (ISO)

transmembrane signaling receptor activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1845873	PMID:17213291	PMID:18991291	PMID:20519654	PMID:20933011

Genomics

Comparative Map Data

Fcrl6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	87,595,058 - 87,604,657 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	13	87,595,058 - 87,604,949 (-)	Ensembl				GRCr8
mRatBN7.2	13	85,062,709 - 85,072,308 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	85,066,694 - 85,072,600 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	13	87,565,846 - 87,575,333 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	88,966,119 - 88,975,598 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	86,150,861 - 86,160,342 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	90,982,814 - 90,992,415 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	90,982,814 - 90,992,406 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	13	95,501,915 - 95,511,516 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	13	88,601,569 - 88,611,170 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	13	84,671,572 - 84,681,173 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

FCRL6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	159,800,512 - 159,816,257 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	159,800,511 - 159,816,262 (+)	Ensembl			hg38	GRCh38
GRCh37	1	159,770,302 - 159,786,047 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	158,038,797 - 158,052,671 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	1	132,840,594 - 132,854,468 (+)	NCBI		Celera
Cytogenetic Map	1	q23.2	NCBI
HuRef	1	131,128,599 - 131,142,473 (+)	NCBI		HuRef
CHM1_1	1	161,167,524 - 161,181,398 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	158,937,524 - 158,953,270 (+)	NCBI		T2T-CHM13v2.0

Fcrl6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	172,423,081 - 172,445,889 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	172,424,209 - 172,430,118 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	1	172,595,514 - 172,618,322 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	172,596,642 - 172,602,551 (-)	Ensembl			mm10	GRCm38
MGSCv37	1	174,526,771 - 174,532,682 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	1	174,528,329 - 174,532,591 (-)	NCBI		MGSCv36	mm8
Celera	1	175,452,446 - 175,458,803 (-)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	80.0	NCBI

Fcrl6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955468	11,581,225 - 11,617,268 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100974844
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	90,038,329 - 90,047,229 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	89,778,352 - 89,792,048 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	135,153,911 - 135,167,699 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	139,072,824 - 139,088,538 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

FCRL6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	22,311,454 - 22,320,105 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	22,387,536 - 22,396,868 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	22,433,000 - 22,442,314 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UNSW_CanFamBas_1.0	38	22,732,350 - 22,741,646 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	23,143,360 - 23,152,706 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Fcrl6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	5,950,574 - 5,960,521 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936740	794,680 - 809,560 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FCRL6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	90,681,364 - 90,700,792 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	90,681,084 - 90,698,102 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	98,655,695 - 98,680,108 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103223750
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	4,134,780 - 4,170,617 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	4,135,153 - 4,148,730 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	3,239,258 - 3,256,054 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fcrl6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624794	1,436,143 - 1,446,215 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Fcrl6
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	10	51,713,489 - 51,722,472 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Fcrl6
58 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	26
Count of miRNA genes:	25
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000000059
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	65613454	109350286	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	21120177	109350286	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	68983334	109350286	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	48639634	93639634	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	62424592	88113509	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	37216241	90057603	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	67635937	109350286	Rat
1576318	Schws5	Schwannoma susceptibility QTL 5		0.0351	nervous system integrity trait (VT:0010566)	post-insult time to trigeminal nerve neurilemmoma formation (CMO:0002019)	13	64497900	109350286	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	11081740	103588154	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	38975045	103588154	Rat
8655951	Rf63	Renal function QTL 63	12.2		blood urea nitrogen amount (VT:0005265)	plasma urea nitrogen level (CMO:0000586)	13	71610804	109350286	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	83286150	109350286	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	71610804	89333251	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	71610804	89333251	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	72984506	99745408	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	71610804	89333251	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	67635937	109350286	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	64375743	109350286	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	6002008	88706694	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	103588154	Rat
724564	Uae11	Urinary albumin excretion QTL 11	5.7		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	13	47354258	94285672	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	67635937	109350286	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
9	1	20	37	47	50	30	68	30	6	150	102	11	18	9	39	20	6	6

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001164726	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	FQ228799	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000059 ⟹ ENSRNOP00000000059

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	87,595,058 - 87,601,461 (-)	Ensembl
mRatBN7.2 Ensembl	13	85,067,286 - 85,069,112 (-)	Ensembl
Rnor_6.0 Ensembl	13	90,982,814 - 90,992,406 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103749 ⟹ ENSRNOP00000091307

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	87,599,043 - 87,604,949 (-)	Ensembl
mRatBN7.2 Ensembl	13	85,066,694 - 85,072,600 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000135709 ⟹ ENSRNOP00000101561

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	13	87,595,058 - 87,604,648 (-)	Ensembl

RefSeq Acc Id:

NM_001164726 ⟹ NP_001158198

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	87,595,058 - 87,604,657 (-)	NCBI
mRatBN7.2	13	85,062,709 - 85,072,308 (-)	NCBI
Rnor_6.0	13	90,982,814 - 90,992,415 (-)	NCBI
Rnor_5.0	13	95,501,915 - 95,511,516 (-)	NCBI
RGSC_v3.4	13	88,601,569 - 88,611,170 (-)	RGD
Celera	13	84,671,572 - 84,681,173 (-)	RGD

Sequence:

show sequence

GGTTTTTCTCTCCCCAGCTTCATCTCTGCCTACTGTCTGACCTGCTCTGCTTCAAGAAAGGCAC
CATGCTGCTCTGGATGGTTCTACTGCTCTGTGTTTCCATGACTGAAGCCCAAGAGTTGTTCCAG
GATCCTGTGCTGAGTCGTCTCAACTCTTCAGAGACATCAGATCTGCTCCTGAAGTGTACAACCA
AGGTGGACCCCAACAAGCCAGCTTCTGAGCTCTTTTACTCTTTCTACAAGGACAACCACATCAT
TCAGAACAGGAGTCACAACCCACTATTTTTCATCTCAGAAGCCAATGAGGAAAACTCTGGGCTT
TACCAGTGTGTGGTGGACGCTAAGGATGGCACAATTCAGAAAAAGAGTGACTATCTGGATATCG
ACCTCTGCACTTCTGTATCCCAACCTGTGCTGACTCTGCAACACGAAGCCACTAACCTTGCTGA
AGGAGACAAAGTGAAGTTTCTTTGTGAGACCCAGCTGGGCTCCCTTCCTATCCTTTACTCATTC
TACATGGATGGAGAGATCCTAGGGGAACCTCTGGCTCCCTCTGGCAGAGCTGCCTCCCTCCTCA
TCTCAGTGAAGGCAGAGTGGAGTGGCAAGAACTACTCCTGTCAAGCTGAAAACAAAGTCTCCAG
AGATATAAGTGAGCCCAAGAAGTTCCCCTTGGTTGTCTCAGGTACTGCCTCGATGAAGAGCACC
ACGATGGTTATCTGGCTACCTGTAAGCTGCTTGGTGGGATGGCCATGGCTGCTGCGGTTCTGAT
TTAGTTCTTCAAGCCCTGCAAAAAAAAAAAACATGGTATGAAAATAAGAGGCTGCTTATCACAG
CAGGTGATTGTGATTTGCCGTCTGCACTAGCAAGGACATGATTCTTGCCAATTGTAGATAATCT
AATTTAGGGGACTCTGGAGAGGGTATGAATGACAGAGCCTAGAGAGGGATTAGGGGCGCTATGA
AGAAGGATGCTGCTGCTGCTGCTGGTCTTCTTGCTCCTGGTGGCTGTTGTTAAGGATTGTCATG
TGGTCGTGTTCAAGAGAAGAAGTCGGAGACATGACTATGAAGATTGGACTTGCTTCAAGGAACC
CAATGCCCCAAATCAGCAGAAAGTAGTATAAAAAAGGTCTATGCCCCCCTTTCCCCTCTAGCCT
TCTTTCTCTCCTAACTAGTGTTTGTGAGTTGGAATTGGGGTGGAAAAGGGTTTGGAGGGGAGGC
GGAGTTATAAGAACCTAATAAAGTAGCTTTCAAAATATCTCAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001158198	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000101561
GenBank Protein	P23505	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001158198 ⟸ NM_001164726
- Peptide Label:	precursor
- UniProtKB:	P23505 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MLLWMVLLLCVSMTEAQELFQDPVLSRLNSSETSDLLLKCTTKVDPNKPASELFYSFYKDNHII QNRSHNPLFFISEANEENSGLYQCVVDAKDGTIQKKSDYLDIDLCTSVSQPVLTLQHEATNLAE GDKVKFLCETQLGSLPILYSFYMDGEILGEPLAPSGRAASLLISVKAEWSGKNYSCQAENKVSR DISEPKKFPLVVSGTASMKSTTMVIWLPVSCLVGWPWLLRF hide sequence

Ensembl Acc Id:

ENSRNOP00000000059 ⟸ ENSRNOT00000000059

Ensembl Acc Id:

ENSRNOP00000091307 ⟸ ENSRNOT00000103749

Ensembl Acc Id:

ENSRNOP00000101561 ⟸ ENSRNOT00000135709

Protein Domains

Ig-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P23505-F1-model_v2	AlphaFold	P23505	1-233	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563939	AgrOrtholog
BioCyc Gene	G2FUF-17298	BioCyc
Ensembl Genes	ENSRNOG00000000055	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000135709	ENTREZGENE
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot
InterPro	Ig-like_dom	UniProtKB/Swiss-Prot
	Ig-like_dom_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Ig_Fc_receptor	UniProtKB/Swiss-Prot
NCBI Gene	305103	ENTREZGENE
PANTHER	FC RECEPTOR-LIKE PROTEIN 2	UniProtKB/Swiss-Prot
	IMMUNOGLOBULIN FC RECEPTOR	UniProtKB/Swiss-Prot
Pfam	Ig_2	UniProtKB/Swiss-Prot
PhenoGen	Fcrl6	PhenoGen
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000000055	RatGTEx
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot
UniProt	A0A8I6ABT7_RAT	UniProtKB/TrEMBL
	A0ABK0LAT6_RAT	UniProtKB/TrEMBL
	F1LME1_RAT	UniProtKB/TrEMBL
	GP42_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-09-17	Fcrl6	Fc receptor-like 6	LOC305103	cell surface glycoprotein gp42	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC305103	cell surface glycoprotein gp42			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message