Advanced Search (OLGA)

Gene: Dkkl1 (dickkopf like acrosomal protein 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Dkkl1

Name:

dickkopf like acrosomal protein 1

RGD ID:

1563523

Description:

Predicted to enable co-receptor binding activity and receptor antagonist activity. Predicted to be involved in several processes, including negative regulation of canonical Wnt signaling pathway; negative regulation of testosterone biosynthetic process; and penetration of zona pellucida. Predicted to act upstream of or within canonical Wnt signaling pathway and positive regulation of fat cell differentiation. Predicted to be located in acrosomal vesicle. Predicted to be active in extracellular space. Orthologous to human DKKL1 (dickkopf like acrosomal protein 1); INTERACTS WITH 3,7-dihydropurine-6-thione; acetamide; Cuprizon.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

dickkopf-like 1; dickkopf-like protein 1; LOC499150; RGD1563523; similar to soggy precursor

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DKKL1 (dickkopf like acrosomal protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Dkkl1 (dickkopf-like 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dkkl1 (dickkopf like acrosomal protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DKKL1 (dickkopf like acrosomal protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DKKL1 (dickkopf like acrosomal protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dkkl1 (dickkopf like acrosomal protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DKKL1 (dickkopf like acrosomal protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DKKL1 (dickkopf like acrosomal protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dkkl1 (dickkopf like acrosomal protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DKKL1 (dickkopf like acrosomal protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dkkl1 (dickkopf-like 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	104,830,462 - 104,835,711 (-)	NCBI		GRCr8
mRatBN7.2	1	95,694,010 - 95,699,259 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	95,694,010 - 95,699,259 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	101,079,409 - 101,084,658 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	109,552,075 - 109,557,324 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	102,842,478 - 102,847,727 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	101,205,426 - 101,210,675 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	101,205,426 - 101,210,675 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	102,270,284 - 102,275,533 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	95,684,794 - 95,690,043 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	89,952,293 - 89,957,542 (-)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dkkl1	Rat	developmental and epileptic encephalopathy 12		ISO	DKKL1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Developmental and epileptic encephalopathy and 12	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dkkl1	Rat	17alpha-ethynylestradiol	affects expression	ISO	Dkkl1 (Mus musculus)	6480464	Ethinyl Estradiol affects the expression of DKKL1 mRNA	CTD	PMID:17555576
Dkkl1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Dkkl1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DKKL1 mRNA	CTD	PMID:17942748
Dkkl1	Rat	17alpha-ethynylestradiol	increases expression	ISO	Dkkl1 (Mus musculus)	6480464	Ethinyl Estradiol results in increased expression of DKKL1 mRNA	CTD	PMID:17942748
Dkkl1	Rat	17beta-estradiol	increases expression	ISO	Dkkl1 (Mus musculus)	6480464	Estradiol results in increased expression of DKKL1 mRNA	CTD	PMID:19484750
Dkkl1	Rat	17beta-estradiol	multiple interactions	ISO	Dkkl1 (Mus musculus)	6480464	[bisphenol A results in increased susceptibility to Estradiol] which results in increased expression of DKKL1 mRNA	CTD	PMID:27312807
Dkkl1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Dkkl1 (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DKKL1 mRNA	CTD	PMID:17942748
Dkkl1	Rat	3,7-dihydropurine-6-thione	decreases expression	EXP		6480464	Mercaptopurine results in decreased expression of DKKL1 mRNA	CTD	PMID:23358152
Dkkl1	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of DKKL1 mRNA	CTD	PMID:31881176
Dkkl1	Rat	arsane	affects expression	ISO	DKKL1 (Homo sapiens)	6480464	Arsenic affects the expression of DKKL1 protein	CTD	PMID:24675094
Dkkl1	Rat	arsenic atom	affects expression	ISO	DKKL1 (Homo sapiens)	6480464	Arsenic affects the expression of DKKL1 protein	CTD	PMID:24675094
Dkkl1	Rat	benzo[a]pyrene	increases expression	ISO	DKKL1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of DKKL1 mRNA	CTD	PMID:22316170
Dkkl1	Rat	Benzo[k]fluoranthene	decreases expression	ISO	Dkkl1 (Mus musculus)	6480464	benzo(k)fluoranthene results in decreased expression of DKKL1 mRNA	CTD	PMID:26377693
Dkkl1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	Dkkl1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of DKKL1 mRNA	CTD	PMID:34319233
Dkkl1	Rat	bisphenol A	multiple interactions	ISO	Dkkl1 (Mus musculus)	6480464	[bisphenol A results in increased susceptibility to Estradiol] which results in increased expression of DKKL1 mRNA	CTD	PMID:27312807
Dkkl1	Rat	bisphenol A	decreases expression	ISO	Dkkl1 (Mus musculus)	6480464	bisphenol A results in decreased expression of DKKL1 mRNA	CTD	PMID:32156529 more ...
Dkkl1	Rat	carbon nanotube	decreases expression	ISO	Dkkl1 (Mus musculus)	6480464	Nanotubes and Carbon analog results in decreased expression of DKKL1 mRNA	CTD	PMID:25554681
Dkkl1	Rat	cisplatin	multiple interactions	ISO	DKKL1 (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of DKKL1 mRNA	CTD	PMID:27392435
Dkkl1	Rat	clorgyline	increases expression	ISO	DKKL1 (Homo sapiens)	6480464	Clorgyline results in increased expression of DKKL1 mRNA	CTD	PMID:19691856
Dkkl1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of DKKL1 mRNA	CTD	PMID:27523638
Dkkl1	Rat	delphinidin	decreases expression	ISO	Dkkl1 (Mus musculus)	6480464	delphinidin results in decreased expression of DKKL1 mRNA	CTD	PMID:38291899
Dkkl1	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of DKKL1 mRNA	CTD	PMID:29391264
Dkkl1	Rat	ethanol	affects expression	ISO	Dkkl1 (Mus musculus)	6480464	Ethanol affects the expression of DKKL1 mRNA	CTD	PMID:30319688
Dkkl1	Rat	ethylparaben	decreases expression	ISO	DKKL1 (Homo sapiens)	6480464	ethyl-p-hydroxybenzoate results in decreased expression of DKKL1 mRNA	CTD	PMID:37690743
Dkkl1	Rat	fenfluramine	increases expression	ISO	DKKL1 (Homo sapiens)	6480464	Fenfluramine results in increased expression of DKKL1 mRNA	CTD	PMID:22140631
Dkkl1	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of DKKL1 mRNA	CTD	PMID:24793618
Dkkl1	Rat	glycidol	increases expression	EXP		6480464	glycidol results in increased expression of DKKL1 mRNA	CTD	PMID:24915197
Dkkl1	Rat	mercaptopurine	decreases expression	EXP		6480464	Mercaptopurine results in decreased expression of DKKL1 mRNA	CTD	PMID:23358152
Dkkl1	Rat	purine-6-thiol	decreases expression	EXP		6480464	Mercaptopurine results in decreased expression of DKKL1 mRNA	CTD	PMID:23358152
Dkkl1	Rat	silicon dioxide	decreases expression	ISO	DKKL1 (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of DKKL1 mRNA	CTD	PMID:25895662
Dkkl1	Rat	sodium fluoride	increases expression	ISO	Dkkl1 (Mus musculus)	6480464	Sodium Fluoride results in increased expression of DKKL1 protein	CTD	PMID:28918527
Dkkl1	Rat	sunitinib	decreases expression	ISO	DKKL1 (Homo sapiens)	6480464	Sunitinib results in decreased expression of DKKL1 mRNA	CTD	PMID:31533062
Dkkl1	Rat	tamoxifen	affects expression	ISO	Dkkl1 (Mus musculus)	6480464	Tamoxifen affects the expression of DKKL1 mRNA	CTD	PMID:17555576
Dkkl1	Rat	thimerosal	decreases expression	ISO	Dkkl1 (Mus musculus)	6480464	Thimerosal results in decreased expression of DKKL1 mRNA	CTD	PMID:24675092
Dkkl1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of DKKL1 mRNA	CTD	PMID:33387578
Dkkl1	Rat	trimellitic anhydride	increases expression	ISO	Dkkl1 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of DKKL1 mRNA	CTD	PMID:19042947
Dkkl1	Rat	triptonide	increases expression	ISO	Dkkl1 (Mus musculus)	6480464	triptonide results in increased expression of DKKL1 mRNA	CTD	PMID:33045310
Dkkl1	Rat	valproic acid	increases expression	ISO	Dkkl1 (Mus musculus)	6480464	Valproic Acid results in increased expression of DKKL1 mRNA	CTD	PMID:21427059
Dkkl1	Rat	valproic acid	decreases expression	ISO	DKKL1 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of DKKL1 mRNA	CTD	PMID:23179753

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dkkl1	Rat	canonical Wnt signaling pathway	acts_upstream_of_or_within	ISO	Dkkl1 (Mus musculus)	1624291	PMID:29715368	RGD	PMID:29715368
Dkkl1	Rat	negative regulation of canonical Wnt signaling pathway	involved_in	IBA	MGI:1329040 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dkkl1	Rat	negative regulation of testosterone biosynthetic process	involved_in	ISO	Dkkl1 (Mus musculus)	1624291	PMID:18818293	RGD	PMID:18818293
Dkkl1	Rat	penetration of zona pellucida	involved_in	ISO	Dkkl1 (Mus musculus)	1624291	PMID:19596312	RGD	PMID:19596312
Dkkl1	Rat	positive regulation of apoptotic process	involved_in	ISO	Dkkl1 (Mus musculus)	1624291	PMID:18818293	RGD	PMID:18818293
Dkkl1	Rat	positive regulation of fat cell differentiation	acts_upstream_of_or_within	ISO	Dkkl1 (Mus musculus)	1624291	PMID:12055200	RGD	PMID:12055200

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dkkl1	Rat	acrosomal vesicle	located_in	ISO	Dkkl1 (Mus musculus)	1624291	PMID:15892050 and PMID:19176879	RGD	PMID:15892050 and PMID:19176879
Dkkl1	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Dkkl1	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dkkl1	Rat	extracellular space	is_active_in	IBA	PANTHER:PTN001383489 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dkkl1	Rat	co-receptor binding	enables	IBA	MGI:1890663 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dkkl1	Rat	protein binding	enables	ISO	Dkkl1 (Mus musculus)	1624291	MGI:1922390 more ...	RGD	PMID:19176879 more ...
Dkkl1	Rat	receptor antagonist activity	enables	IBA	PANTHER:PTN001383489 and UniProtKB:O94907	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12055200	PMID:15892050	PMID:18818293	PMID:19176879	PMID:19596312

Dkkl1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	104,830,462 - 104,835,711 (-)	NCBI		GRCr8
mRatBN7.2	1	95,694,010 - 95,699,259 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	95,694,010 - 95,699,259 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	101,079,409 - 101,084,658 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	109,552,075 - 109,557,324 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	102,842,478 - 102,847,727 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	101,205,426 - 101,210,675 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	101,205,426 - 101,210,675 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	102,270,284 - 102,275,533 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	95,684,794 - 95,690,043 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	89,952,293 - 89,957,542 (-)	NCBI		Celera
Cytogenetic Map	1	q22	NCBI

DKKL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	49,360,515 - 49,375,116 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	49,361,783 - 49,375,116 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	49,867,134 - 49,878,373 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	54,558,854 - 54,570,185 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	54,558,853 - 54,570,183	NCBI
Celera	19	46,733,898 - 46,745,228 (+)	NCBI		Celera
Cytogenetic Map	19	q13.33	NCBI
HuRef	19	46,243,555 - 46,254,943 (+)	NCBI		HuRef
CHM1_1	19	49,868,966 - 49,880,350 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	52,357,951 - 52,372,571 (+)	NCBI		T2T-CHM13v2.0

Dkkl1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	44,856,949 - 44,861,592 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	44,856,943 - 44,861,571 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	45,207,525 - 45,212,165 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	45,207,519 - 45,212,147 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	52,462,895 - 52,467,253 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	45,075,567 - 45,079,892 (-)	NCBI		MGSCv36	mm8
Celera	7	40,663,416 - 40,667,775 (-)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	29.19	NCBI

Dkkl1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955559	1,445,149 - 1,449,004 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955559	1,445,082 - 1,449,167 (-)	NCBI	ChiLan1.0	ChiLan1.0

DKKL1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	55,479,696 - 55,493,609 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	57,398,633 - 57,413,230 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	46,375,301 - 46,389,822 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	55,300,173 - 55,313,690 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	55,301,955 - 55,313,690 (+)	Ensembl	panpan1.1		panPan2

DKKL1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	107,109,787 - 107,113,932 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	107,109,791 - 107,113,811 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	106,693,253 - 106,697,206 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	107,630,262 - 107,634,229 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	107,630,266 - 107,634,131 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	107,303,172 - 107,307,137 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	106,945,347 - 106,949,315 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	107,786,470 - 107,790,436 (-)	NCBI		UU_Cfam_GSD_1.0

Dkkl1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	21,638,880 - 21,645,597 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936664	3,257,698 - 3,264,565 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936664	3,257,744 - 3,263,787 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DKKL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	54,463,759 - 54,468,361 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	54,462,367 - 54,468,363 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

DKKL1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	42,544,459 - 42,555,653 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	42,547,593 - 42,555,566 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666073	22,470,364 - 22,482,443 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dkkl1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	4,816,277 - 4,819,740 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624832	4,816,383 - 4,820,082 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Dkkl1
7 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	61
Count of miRNA genes:	55
Interacting mature miRNAs:	56
Transcripts:	ENSRNOT00000028082
Prediction methods:	Microtar, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	78479925	123479925	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	85424647	100358001	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	94494440	117601394	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	90532338	123479925	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	77876254	106047988	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	82174743	118944897	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889494	Scort2	Serum corticosterone level QTL 2	4.2		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	80592172	125592172	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	92948896	144267916	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
61344	Bp29	Blood pressure QTL 29	7.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	78350581	123350581	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	77494165	122494165	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514)	1	83547917	128547917	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	77857876	122857876	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	78430536	123430536	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	92184926	137184926	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
4	8	31	80	60	59	43	13	43	2	136	52	72	31	58	16


RefSeq Transcripts	NM_001109145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC099450	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000028082 ⟹ ENSRNOP00000028082

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	95,694,010 - 95,699,259 (-)	Ensembl
Rnor_6.0 Ensembl	1	101,205,426 - 101,210,675 (-)	Ensembl

RefSeq Acc Id:

NM_001109145 ⟹ NP_001102615

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	104,830,462 - 104,835,711 (-)	NCBI
mRatBN7.2	1	95,694,010 - 95,699,259 (-)	NCBI
Rnor_6.0	1	101,205,426 - 101,210,675 (-)	NCBI
Rnor_5.0	1	102,270,284 - 102,275,533 (-)	NCBI
RGSC_v3.4	1	95,684,794 - 95,690,043 (-)	RGD
Celera	1	89,952,293 - 89,957,542 (-)	RGD

Sequence:

show sequence

TAAATGCCTGGTTTGTGAGTAAGGTCACCAGATGTGGGCGTGGCCTTCCATGAGGAGGTCTAGCTTAAGAGGCGTGGTTAATGAACAATACAGATGTGGATTTGCCAGAAACATGATGGTGGAGTAGT
GAGGATTATGGTGGAGTAGTAAGGATTCTAGGTGACAGTGGGTGGTGGGCGTGGTGAGACAATGGGGCGTGGCCAGTCTCGCGGAGAGGTGGCACCCAACGAACGAACGCTCCAGTAATTTGCCCAGG
CTCGAGACCAGAACTGGATTTTAACTGCCCGTATCCGGCGGTGTCCGGAGCCGGGTGGCCGAGCTGCAGTCCAGGAGAAGGCGCGAATGTAGGCAAAGCCTCCCACACAACTGCAATGGGTCGACTGG
GAGTCCTGTTGCTGCTGCTCCCCTTGGCCTTTGTGTGCGCCTCTGCTGTACCGATCCATGATGCCGACTCTCAGCAGAACTCCTCCGGATTTCTGGGCCTTCAGAGTCTTCTTCAAAGCTTTAGTCGA
CTGTTCCTAAAAAATGACCTGCTACAAGACCTGGACAACTTCTTCTCCTCCCCCATGGACTTCCGAGACCTTCCTAGGAACTTCCATCAGGAACAGAACCAGGAGCACAGAATGGGAAACCATACCCT
CTCCAGCCACCTACAGATAGACAAGATGACTGACAACCAGACAGGGGAGGTGCTCATCTCCGAGAAGGTGGTGGCTTCCATTGAGCCAGAAGTGAACCCAGAAGGTGACTGGAAGGTGCCCAAAGTGG
AGGCGAAAGAGGCCCTGGTGCCCGTGCAGAAGGCCACCGACAGTTTGCACCCAGAGCCCCGGCGGGTGGCTTTCTGGATTATGAAGATGCCAAGACGGAGGACCCAGCCAGATGTCCAGGACGGAAAC
CGCTGGCTCACAGAAAAGCGGCACCGCATGCAGGCCATCCGGGATGGGCTCCGAGGAGGCGCCCATGAGGACAACCTTGAGGAAGGGGTCCATGTGCCCCAACACGCCAAGGTGCCCATCCGAAAGAC
ACACTTTCTCTACATCTTCAGGCCATCCCAGCAGCTATAAGGTGGGGACCGTGTATCCCTGCATGTCCTACACCCTACCCCAACACCATATGGAAATAAAGTTTTTTCTTACATCT

hide sequence


Protein RefSeqs	NP_001102615	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM07390	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028082.3

RefSeq Acc Id:	NP_001102615 ⟸ NM_001109145
- Peptide Label:	precursor
- UniProtKB:	D4A444 (UniProtKB/TrEMBL), A6JAZ4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGRLGVLLLLLPLAFVCASAVPIHDADSQQNSSGFLGLQSLLQSFSRLFLKNDLLQDLDNFFSSPMDFRDLPRNFHQEQNQEHRMGNHTLSSHLQIDKMTDNQTGEVLISEKVVASIEPEVNPEGDWK VPKVEAKEALVPVQKATDSLHPEPRRVAFWIMKMPRRRTQPDVQDGNRWLTEKRHRMQAIRDGLRGGAHEDNLEEGVHVPQHAKVPIRKTHFLYIFRPSQQL hide sequence

Ensembl Acc Id:

ENSRNOP00000028082 ⟸ ENSRNOT00000028082

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A444-F1-model_v2	AlphaFold	D4A444	1-230	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13690032

Promoter ID:

EPDNEW_R556

Type:

initiation region

Name:

Dkkl1_1

Description:

dickkopf like acrosomal protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	101,210,410 - 101,210,470	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-59703	BioCyc
Ensembl Genes	ENSRNOG00000020686	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000028082.5	UniProtKB/TrEMBL
InterPro	DKK1-4	UniProtKB/TrEMBL
	DKKL1	UniProtKB/TrEMBL
KEGG Report	rno:499150	UniProtKB/TrEMBL
NCBI Gene	499150	ENTREZGENE
PANTHER	DICKKOPF-LIKE PROTEIN 1	UniProtKB/TrEMBL
	DICKKOPF3-LIKE 3	UniProtKB/TrEMBL
PhenoGen	Dkkl1	PhenoGen
RatGTEx	ENSRNOG00000020686	RatGTEx
UniProt	A6JAZ4	ENTREZGENE, UniProtKB/TrEMBL
	D4A444	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-19	Dkkl1	dickkopf like acrosomal protein 1	Dkkl1	dickkopf-like 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Dkkl1	dickkopf-like 1	RGD1563523_predicted	similar to soggy precursor (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1563523_predicted	similar to soggy precursor (predicted)	LOC499150	similar to soggy precursor	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC499150	similar to soggy precursor			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar