Advanced Search (OLGA)

Gene: Zfp385c (zinc finger protein 385C) Rattus norvegicus

Analyze

Symbol:

Zfp385c

Name:

zinc finger protein 385C

RGD ID:

1563442

Description:

Predicted to enable nucleic acid binding activity and zinc ion binding activity. Predicted to be active in nucleus. Orthologous to human ZNF385C (zinc finger protein 385C); INTERACTS WITH alpha-Zearalanol; amphetamine; cyclophosphamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC303537; RGD1563442; similar to hypothetical protein A930006D11

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ZNF385C (zinc finger protein 385C)	HGNC	Ensembl, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Zfp385c (zinc finger protein 385C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Znf385c (zinc finger protein 385C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ZNF385C (zinc finger protein 385C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LOC490972 (transmembrane protein C17orf113)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Znf385c (zinc finger protein 385C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ZNF385C (zinc finger protein 385C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Znf385c (zinc finger protein 385C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Znf385c (zinc finger protein 385C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	IL10RB (interleukin 10 receptor subunit beta)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	ZNF385C (zinc finger protein 385C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Zfp385c (zinc finger protein 385C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	znf385c (zinc finger protein 385C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	znf385c (zinc finger protein 385C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	znf385c	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	znf385c	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	86,062,329 - 86,118,454 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	86,062,512 - 86,106,063 (-)	Ensembl				GRCr8
mRatBN7.2	10	85,562,003 - 85,618,100 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	85,562,820 - 85,582,986 (-)	Ensembl				mRatBN7.2
Rnor_6.0	10	88,541,759 - 88,597,058 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	88,541,657 - 88,551,056 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	88,334,994 - 88,391,257 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	89,572,056 - 89,599,208 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	84,279,322 - 84,314,865 (-)	NCBI		Celera
Cytogenetic Map	10	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,4,4'-trichlorobiphenyl (ISO)

acrylamide (ISO)

alpha-Zearalanol (EXP)

amphetamine (EXP)

aristolochic acid A (ISO)

atrazine (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cyclophosphamide (EXP)

dorsomorphin (ISO)

hydrogen peroxide (ISO)

lead(0) (ISO)

methoxychlor (EXP)

nickel atom (ISO)

okadaic acid (ISO)

PCB138 (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenylmercury acetate (ISO)

pioglitazone (ISO)

pirinixic acid (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

Theaflavin 3,3'-digallate (ISO)

titanium dioxide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

nucleus (IBA,IEA)

Molecular Function

metal ion binding (IEA)

nucleic acid binding (IEA)

protein binding (ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932

Genomics

Comparative Map Data

Zfp385c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	86,062,329 - 86,118,454 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	86,062,512 - 86,106,063 (-)	Ensembl				GRCr8
mRatBN7.2	10	85,562,003 - 85,618,100 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	85,562,820 - 85,582,986 (-)	Ensembl				mRatBN7.2
Rnor_6.0	10	88,541,759 - 88,597,058 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	88,541,657 - 88,551,056 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	88,334,994 - 88,391,257 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	89,572,056 - 89,599,208 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	84,279,322 - 84,314,865 (-)	NCBI		Celera
Cytogenetic Map	10	q31	NCBI

ZNF385C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	42,025,576 - 42,098,473 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	42,025,576 - 42,098,479 (-)	Ensembl			hg38	GRCh38
GRCh37	17	40,177,594 - 40,250,491 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	37,431,120 - 37,434,233 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	17	36,832,645 - 36,835,757 (-)	NCBI		Celera
Cytogenetic Map	17	q21.2	NCBI
HuRef	17	35,942,822 - 35,955,266 (-)	NCBI		HuRef
CHM1_1	17	40,413,334 - 40,425,785 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	42,882,106 - 42,954,978 (-)	NCBI		T2T-CHM13v2.0

Zfp385c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	100,517,045 - 100,583,292 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	100,518,369 - 100,583,281 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	100,626,219 - 100,692,466 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	100,627,543 - 100,692,455 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	100,487,533 - 100,512,007 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	100,443,636 - 100,466,783 (-)	NCBI		MGSCv36	mm8
Celera	11	111,246,542 - 111,272,113 (-)	NCBI		Celera
Cytogenetic Map	11	D	NCBI
cM Map	11	63.47	NCBI

Znf385c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	16,151,752 - 16,156,942 (-)	Ensembl
ChiLan1.0	NW_004955451	16,151,562 - 16,184,179 (-)	NCBI	ChiLan1.0	ChiLan1.0

ZNF385C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	22,885,574 - 22,957,966 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	24,775,681 - 24,847,408 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	15,217,496 - 15,290,500 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	15,501,009 - 15,509,818 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	15,473,601 - 15,509,818 (+)	Ensembl			panPan2	panpan1.1

LOC490972
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	20,827,002 - 20,850,854 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	20,837,045 - 20,840,919 (+)	Ensembl			canFam3	CanFam3.1
CanFam3.1 Ensembl	9	20,837,045 - 20,840,919 (+)	NCBI			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	20,258,510 - 20,311,762 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	21,516,342 - 21,569,613 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	21,540,165 - 21,559,072 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	20,301,616 - 20,354,856 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	20,568,739 - 20,621,955 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	20,671,790 - 20,725,080 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Znf385c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	20,136,657 - 20,188,361 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	16,887,879 - 16,908,489 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	16,886,778 - 16,908,607 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ZNF385C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	12	20,688,877 - 20,717,608 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	20,983,565 - 21,007,743 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Znf385c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624795	1,821,717 - 1,826,514 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624795	1,795,477 - 1,827,458 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Znf385c
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	59,927,822 - 59,969,204 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Zfp385c
324 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	301
Count of miRNA genes:	141
Interacting mature miRNAs:	160
Transcripts:	ENSRNOT00000032737, ENSRNOT00000067662
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	51071897	96071897	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
631555	Bp134	Blood pressure QTL 134		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	81012077	91729860	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	58073360	103073360	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	54296336	99451733	Rat
4889948	Bss91	Bone structure and strength QTL 91	4		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	10	83061236	92869129	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41831278	86831278	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76951790	107713808	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50464802	95464802	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	79272424	102982300	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	73599825	107713808	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45529164	96099749	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44939359	89939359	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
10450495	Bp383	Blood pressure QTL 383		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76743133	95464802	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50860288	95860288	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2292617	Ept18	Estrogen-induced pituitary tumorigenesis QTL 18	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73950353	96620293	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42823274	87823274	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	67241334	98502431	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44939359	89939359	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42823274	87823274	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61843496	98710773	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	73695339	97272278	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
6893357	Bw102	Body weight QTL 102	0.5	0.36	body mass (VT:0001259)	body weight (CMO:0000012)	10	81012077	101828297	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
2306793	Ean5	Experimental allergic neuritis QTL 5	4.7		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	73049656	94495280	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	49495492	94495492	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68920187	107713808	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70698731	107713808	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	55307972	93608131	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61843496	100198886	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	43608793	88608793	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49943710	94943710	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44939359	89939359	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61843496	100198886	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47869129	92869129	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
12880055	Am11	Aortic mass QTL 11		0.004	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	84503487	96432422	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76743133	95604677	Rat
2301398	Kidm38	Kidney mass QTL 38		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	84503487	96432422	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50604677	95604677	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	76128947	107713808	Rat
1358188	Ept9	Estrogen-induced pituitary tumorigenesis QTL 9	3.9		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	10	73950353	96620293	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

D10Got124

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	85,565,469 - 85,565,619 (+)	MAPPER	mRatBN7.2
mRatBN7.2	10	85,565,469 - 85,565,684 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	88,544,136 - 88,544,394	NCBI	Rnor6.0
Rnor_6.0	10	88,544,136 - 88,544,285	NCBI	Rnor6.0
Rnor_5.0	10	88,338,460 - 88,338,609	UniSTS	Rnor5.0
Rnor_5.0	10	88,338,460 - 88,338,718	UniSTS	Rnor5.0
RGSC_v3.4	10	89,575,060 - 89,575,209	UniSTS	RGSC3.4
RGSC_v3.4	10	89,575,059 - 89,575,209	RGD	RGSC3.4
Celera	10	84,281,700 - 84,281,849	UniSTS
RGSC_v3.1	10	89,589,430 - 89,589,579	RGD
RH 3.4 Map	10	838.5	UniSTS
RH 3.4 Map	10	838.5	RGD
RH 2.0 Map	10	966.6	RGD
Cytogenetic Map	10	q32.1	UniSTS

AI763749

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	85,562,098 - 85,562,242 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	88,540,766 - 88,540,908	NCBI	Rnor6.0
Rnor_5.0	10	88,335,090 - 88,335,232	UniSTS	Rnor5.0
RGSC_v3.4	10	89,571,690 - 89,571,832	UniSTS	RGSC3.4
Celera	10	84,278,329 - 84,278,471	UniSTS
RH 3.4 Map	10	859.8	UniSTS
Cytogenetic Map	10	q32.1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
14	12	65	153	72	71	40	92	40	6	331	190	11	128	79	92	31	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001430202	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001430203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001430204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001430205	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001430206	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006220846	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006247466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008768216	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008768218	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597717	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597718	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017604144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017604145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087736	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087737	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087740	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC162044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000032737 ⟹ ENSRNOP00000031848

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	86,063,145 - 86,083,307 (-)	Ensembl
mRatBN7.2 Ensembl	10	85,562,820 - 85,582,986 (-)	Ensembl
Rnor_6.0 Ensembl	10	88,541,657 - 88,551,056 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000135407 ⟹ ENSRNOP00000107029

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	86,062,512 - 86,099,032 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000135553 ⟹ ENSRNOP00000099409

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	86,062,512 - 86,098,970 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000141671 ⟹ ENSRNOP00000109629

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	86,063,145 - 86,106,063 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000150987 ⟹ ENSRNOP00000110435

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	86,063,145 - 86,099,595 (-)	Ensembl

RefSeq Acc Id:

XM_006247466 ⟹ XP_006247528

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	86,062,329 - 86,100,355 (-)	NCBI
mRatBN7.2	10	85,562,003 - 85,600,082 (-)	NCBI
Rnor_6.0	10	88,541,759 - 88,577,962 (-)	NCBI
Rnor_5.0	10	88,334,994 - 88,391,257 (-)	NCBI

Sequence:

show sequence

GCTCTTCAGCCAGAGGAAGGAGTCCCTCTCTGTCTAGTTCTCCAGAGCCGGGCCGGAGAGGCTC
CTGGCAGCTACTGGGGCGGGCGCAGGCCGTGCAGGGGCGGGCTCAGAGGAGGCGCGGGACAGGA
ACCGGCCAGCTGCAACTGCAATCGCAAATCGTCCTGGTGCCGCTCAGTGGGGTGCGTCCTTGGC
CCTGTTCAGGTATGAAACGGCCACTGAGCCCACCCCCGTCAGGTGAGAAGGAGCCCCCCACAAC
TGCTGCATCTGAGTGCCCCCCTCACTCTCCAGAATCATCGAAGCCTAAGCGGGAAAGGAAACGA
CCCTCCTACACACTGTGCGATGTCTGCAACATCCAGCTGAACTCTGCCGCTCAGGCCCAGGTGC
ATTGTGGGGGACGCGCCCACCAGCGAAGGCTTCGGCAGCTCAGCCTGGGCAAGACCTCCACAGG
GCCAGCAGGCCCGGCCTCCAGCGCCCCCAGCCCCTTGCTGGCCTCCCTGACCCTGCCCACCCAG
CCTCTGCAACCCCCACTGGACTTGAAGCACTTACTCGCCTTCCACCTCAATGGCACCACCCCGC
TCAGTCTCTTCCCCAACTTCAGCACGATGGACCCAGTCCAGAAAGCTGTCATCAGCCACACGTT
TGGGGTCCCTTCCCCTCTGAAGAAGAAGCTGTTCATCTCCTGTAACATCTGTCATCTGAGGTTC
AACTCAGCGAACCAGGCCGAAGCTCATTACAAGGGCCATAGACACGCCAGAAAACTCAAGGCTG
TGGAAGCTGCCAAGAGCAAGCAGAGGCCTCGAAACCTGACCACAAATGGGACAGTGGCGTCTAC
AGCCTCACCTCCAGCCAGCGGAAGCCCCGGAAACCCTCAGAGCAAAGATCCAGCATCCCCTCCT
CGAGGCCCTTCACTTCAGCTACCACCGACCCCAGACCCATCAACCAGAGACCCAGCCCACTCAG
AACTTTCTGATGCTGCCGCTTCCTCGTCCTCCTCTTCCTGCCCGCCCTGCTCCCCGGATCCTAG
CAGGGAAGCACCAGGGCCTGAGCCAGCAGAAGTGGCTGCAGGAAATGGAGTGAATGGGGAAGGC
AGGGGTGAGAAGGGCCGCCTCTACTGCCCTACCTGTAAAGTGACCGTGAACTCGGCCTCTCAGC
TTCAGGCTCACAACACAGGAGCTAAGCACAGATGGATGGTGGAAGGTCATCAGGGCGCTCCCCG
AAGGGGCCGGGGCCGTCCTGTGTCCCGAGGAGGAACTGGACACAAGACAAAGAGAGTGATAGGA
AATCGTGGGGGCCGGCAGGGACCCAACCCTCCTTTCCATTGTGCCCTCTGTCAGCTCCATGTCA
ATTCAGAGACCCAGCTCAAGCAGCACATGAGCAGCCGGAGGCACAAAGACCGGCTGGCTGGGAA
GCCCCCCAAGTCCTCCAGCCAGCACAGCAAACTGCAGAAACACACAGCACTGGCTGTGAGTGTT
CTCAAGTCTAAATTGGCCTTGCAGAAGCAACTCACCAAGACGCTGGCAGCCCGCTTCCTGCCCG
GTCCGCTGCCCACCACAGCTGCTGCCATCTGTGCCCTGCCAGGGCCCCTGACCCTCCGGCCTGC
CGCCACGGCAGCTGCTACCCTCTTCCCAGCTCCTGTCCTGGGTCCAGCTCTGTTTCGCACTCCT
GCGGGAGCTGTCCGCCCTGCTGCAGGACCCATCCTTTTTGCTCCCTATTAGTGGATGGCCACAT
CCTATCTCTCCAAGCCGGATACTTGTCTCCACATCCCAAAGAGACTGCCTTTTGCAGTTTCCGG
GTTCCCACCCAACCTGGG

hide sequence

RefSeq Acc Id:

XM_039087736 ⟹ XP_038943664

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	86,062,329 - 86,118,451 (-)	NCBI
mRatBN7.2	10	85,562,003 - 85,618,097 (-)	NCBI

RefSeq Acc Id:

XM_039087737 ⟹ XP_038943665

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	86,062,329 - 86,108,293 (-)	NCBI
mRatBN7.2	10	85,562,003 - 85,605,857 (-)	NCBI

RefSeq Acc Id:

XM_039087739 ⟹ XP_038943667

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	86,062,329 - 86,118,453 (-)	NCBI
mRatBN7.2	10	85,562,003 - 85,618,100 (-)	NCBI

RefSeq Acc Id:

XM_039087740 ⟹ XP_038943668

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	86,062,329 - 86,118,454 (-)	NCBI
mRatBN7.2	10	85,562,003 - 85,618,100 (-)	NCBI

RefSeq Acc Id:

XM_063270148 ⟹ XP_063126218

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	86,062,329 - 86,118,451 (-)	NCBI

RefSeq Acc Id:

XM_063270149 ⟹ XP_063126219

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	86,062,329 - 86,100,356 (-)	NCBI

RefSeq Acc Id:

XM_063270150 ⟹ XP_063126220

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	86,062,329 - 86,118,454 (-)	NCBI

RefSeq Acc Id:

XM_063270151 ⟹ XP_063126221

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	86,062,329 - 86,118,445 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001417131	(Get FASTA)	NCBI Sequence Viewer
	NP_001417132	(Get FASTA)	NCBI Sequence Viewer
	NP_001417133	(Get FASTA)	NCBI Sequence Viewer
	NP_001417134	(Get FASTA)	NCBI Sequence Viewer
	NP_001417135	(Get FASTA)	NCBI Sequence Viewer
	XP_006247528	(Get FASTA)	NCBI Sequence Viewer
	XP_038943664	(Get FASTA)	NCBI Sequence Viewer
	XP_038943665	(Get FASTA)	NCBI Sequence Viewer
	XP_038943667	(Get FASTA)	NCBI Sequence Viewer
	XP_038943668	(Get FASTA)	NCBI Sequence Viewer
	XP_063126218	(Get FASTA)	NCBI Sequence Viewer
	XP_063126219	(Get FASTA)	NCBI Sequence Viewer
	XP_063126220	(Get FASTA)	NCBI Sequence Viewer
	XP_063126221	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI62044	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000031848
	ENSRNOP00000031848.6
	ENSRNOP00000099409.1
	ENSRNOP00000107029
	ENSRNOP00000107029.1
	ENSRNOP00000109629
	ENSRNOP00000109629.1
	ENSRNOP00000110435
	ENSRNOP00000110435.1

RefSeq Acc Id:

XP_006247528 ⟸ XM_006247466

- Peptide Label:

isoform X1

- Sequence:

show sequence

MKRPLSPPPSGEKEPPTTAASECPPHSPESSKPKRERKRPSYTLCDVCNIQLNSAAQAQVHCGG
RAHQRRLRQLSLGKTSTGPAGPASSAPSPLLASLTLPTQPLQPPLDLKHLLAFHLNGTTPLSLF
PNFSTMDPVQKAVISHTFGVPSPLKKKLFISCNICHLRFNSANQAEAHYKGHRHARKLKAVEAA
KSKQRPRNLTTNGTVASTASPPASGSPGNPQSKDPASPPRGPSLQLPPTPDPSTRDPAHSELSD
AAASSSSSSCPPCSPDPSREAPGPEPAEVAAGNGVNGEGRGEKGRLYCPTCKVTVNSASQLQAH
NTGAKHRWMVEGHQGAPRRGRGRPVSRGGTGHKTKRVIGNRGGRQGPNPPFHCALCQLHVNSET
QLKQHMSSRRHKDRLAGKPPKSSSQHSKLQKHTALAVSVLKSKLALQKQLTKTLAARFLPGPLP
TTAAAICALPGPLTLRPAATAAATLFPAPVLGPALFRTPAGAVRPAAGPILFAPY

hide sequence

Ensembl Acc Id:

ENSRNOP00000031848 ⟸ ENSRNOT00000032737

RefSeq Acc Id:	XP_038943667 ⟸ XM_039087739
- Peptide Label:	isoform X2
- UniProtKB:	B1WC87 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038943668 ⟸ XM_039087740
- Peptide Label:	isoform X3
- UniProtKB:	B1WC87 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038943664 ⟸ XM_039087736
- Peptide Label:	isoform X1
- UniProtKB:	B1WC87 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038943665 ⟸ XM_039087737
- Peptide Label:	isoform X1
- UniProtKB:	B1WC87 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063126220 ⟸ XM_063270150
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063126218 ⟸ XM_063270148
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063126221 ⟸ XM_063270151
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_063126219 ⟸ XM_063270149
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000109629 ⟸ ENSRNOT00000141671

Ensembl Acc Id:

ENSRNOP00000099409 ⟸ ENSRNOT00000135553

Ensembl Acc Id:

ENSRNOP00000107029 ⟸ ENSRNOT00000135407

Ensembl Acc Id:

ENSRNOP00000110435 ⟸ ENSRNOT00000150987

Protein Domains

C2H2-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZE95-F1-model_v2	AlphaFold	D3ZE95	1-370	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1563442	AgrOrtholog
BioCyc Gene	G2FUF-23226	BioCyc
Ensembl Genes	ENSRNOG00000025370	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000032737	ENTREZGENE
	ENSRNOT00000032737.8	UniProtKB/TrEMBL
	ENSRNOT00000135407	ENTREZGENE
	ENSRNOT00000135407.1	UniProtKB/TrEMBL
	ENSRNOT00000135553.1	UniProtKB/TrEMBL
	ENSRNOT00000141671	ENTREZGENE
	ENSRNOT00000141671.1	UniProtKB/TrEMBL
	ENSRNOT00000150987	ENTREZGENE
	ENSRNOT00000150987.1	UniProtKB/TrEMBL
Gene3D-CATH	Classic Zinc Finger	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7106588	IMAGE-MGC_LOAD
InterPro	Znf385	UniProtKB/TrEMBL
	Znf_C2H2_sf	UniProtKB/TrEMBL
	Znf_C2H2_type	UniProtKB/TrEMBL
	Znf_U1	UniProtKB/TrEMBL
MGC_CLONE	MGC:188003	IMAGE-MGC_LOAD
NCBI Gene	303537	ENTREZGENE
PANTHER	DOUBLE-STRANDED RNA-BINDING ZINC FINGER PROTEIN	UniProtKB/TrEMBL
	ZINC FINGER PROTEIN 385C	UniProtKB/TrEMBL
Pfam	zf-met	UniProtKB/TrEMBL
PhenoGen	Zfp385c	PhenoGen
PROSITE	ZINC_FINGER_C2H2_1	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000025370	RatGTEx
SMART	ZnF_C2H2	UniProtKB/TrEMBL
	ZnF_U1	UniProtKB/TrEMBL
Superfamily-SCOP	SSF57667	UniProtKB/TrEMBL
UniProt	A0ABK0KXG6_RAT	UniProtKB/TrEMBL
	A0ABK0LTZ4_RAT	UniProtKB/TrEMBL
	A0ABK0LUI7_RAT	UniProtKB/TrEMBL
	A0ABK0M5N4_RAT	UniProtKB/TrEMBL
	B1WC87	ENTREZGENE, UniProtKB/TrEMBL
	D3ZE95	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-31	Zfp385c	zinc finger protein 385C	RGD1563442_predicted	similar to hypothetical protein A930006D11 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1563442_predicted	similar to hypothetical protein A930006D11 (predicted)	LOC303537	similar to hypothetical protein A930006D11	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC303537	similar to hypothetical protein A930006D11			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message