Advanced Search (OLGA)

Gene: Cxcl16 (C-X-C motif chemokine ligand 16) Rattus norvegicus

Analyze

Symbol:

Cxcl16

Name:

C-X-C motif chemokine ligand 16

RGD ID:

1562928

Description:

Predicted to enable chemokine activity; low-density lipoprotein particle receptor activity; and scavenger receptor activity. Predicted to be involved in several processes, including cellular response to lipopolysaccharide; response to tumor necrosis factor; and response to type II interferon. Predicted to be located in membrane. Predicted to be active in extracellular space. Orthologous to human CXCL16 (C-X-C motif chemokine ligand 16); PARTICIPATES IN chemokine mediated signaling pathway; cytokine mediated signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-diaminodiphenylmethane.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

C-X-C motif chemokine 16; chemokine (C-X-C motif) ligand 16; similar to chemokine (C-X-C motif) ligand 16; small-inducible cytokine B16; transmembrane chemokine CXCL16

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	55,665,355 - 55,669,950 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	55,664,742 - 55,670,226 (-)	Ensembl				GRCr8
mRatBN7.2	10	55,166,721 - 55,171,316 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	55,166,723 - 55,171,592 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	59,845,644 - 59,850,516 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	59,334,153 - 59,339,026 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	54,833,353 - 54,838,107 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	57,060,005 - 57,064,600 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	57,060,007 - 57,064,600 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	56,817,242 - 56,821,837 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	57,296,126 - 57,300,721 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	54,313,016 - 54,317,611 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

Experimental Liver Cirrhosis (ISO)

systemic scleroderma (ISO)

viral pneumonia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

1-octadec-9-enoylglycero-3-phosphate (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrolein (ISO)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

anthra[1,9-cd]pyrazol-6(2H)-one (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

beta-lapachone (ISO)

beta-naphthoflavone (EXP)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (EXP)

butan-1-ol (ISO)

Butylbenzyl phthalate (EXP)

caffeine (ISO)

cantharidin (ISO)

carbon nanotube (ISO)

chenodeoxycholic acid (ISO)

choline (ISO)

cisplatin (ISO)

cobalt atom (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

cypermethrin (EXP)

DDE (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dioxygen (ISO)

endosulfan (EXP)

epoxiconazole (ISO)

ethanol (ISO)

fentanyl (EXP)

flutamide (EXP)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

glycine betaine (EXP)

L-methionine (ISO)

lidocaine (EXP)

lipopolysaccharide (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

monocrotaline (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

naled (ISO)

nickel atom (ISO)

nickel dichloride (ISO)

nickel sulfate (ISO)

oxaliplatin (EXP)

paracetamol (EXP)

paraquat (EXP)

perfluorononanoic acid (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

propiconazole (EXP)

quercetin (ISO)

silicon dioxide (ISO)

simvastatin (EXP)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

succimer (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

taurocholic acid (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene 2,4-diisocyanate (ISO)

topotecan (EXP)

trichloroethene (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

zinc atom (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to lipopolysaccharide (ISO)

chemotaxis (IEA)

lymphocyte chemotaxis (IEA)

positive regulation of cell growth (IEA,ISO)

positive regulation of cell migration (IBA,IEA,ISO)

receptor-mediated endocytosis (IEA)

response to cytokine (IEA,ISO)

response to tumor necrosis factor (IEA,ISO)

response to type II interferon (IEA,ISO)

signal transduction (IEA)

T cell chemotaxis (IBA,ISO)

Cellular Component

extracellular space (IBA,IEA,ISO)

membrane (IEA,ISO)

Molecular Function

chemokine activity (IBA,IEA,ISO)

chemokine receptor binding (ISO)

cytokine activity (IEA)

low-density lipoprotein particle receptor activity (IBA,IEA,ISO)

scavenger receptor activity (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

cytokine mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Imbalanced Host Response to SARS-CoV-2 Drives Development of COVID-19.	Blanco-Melo D, etal., Cell. 2020 May 28;181(5):1036-1045.e9. doi: 10.1016/j.cell.2020.04.026. Epub 2020 May 15.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Serum chemokine and cytokine levels as indicators of disease activity in patients with systemic sclerosis.	Hasegawa M, etal., Clin Rheumatol. 2011 Feb;30(2):231-7. Epub 2010 Nov 4.
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	Dysregulated expression of MIG/CXCL9, IP-10/CXCL10 and CXCL16 and their receptors in systemic sclerosis.	Rabquer BJ, etal., Arthritis Res Ther. 2011 Feb 8;13(1):R18.
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:11017100	PMID:11060282	PMID:15890643	PMID:18373975	PMID:19919988	PMID:24006456	PMID:29030988	PMID:35512476

Genomics

Comparative Map Data

Cxcl16
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	55,665,355 - 55,669,950 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	55,664,742 - 55,670,226 (-)	Ensembl				GRCr8
mRatBN7.2	10	55,166,721 - 55,171,316 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	55,166,723 - 55,171,592 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	59,845,644 - 59,850,516 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	59,334,153 - 59,339,026 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	54,833,353 - 54,838,107 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	57,060,005 - 57,064,600 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	57,060,007 - 57,064,600 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	56,817,242 - 56,821,837 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	57,296,126 - 57,300,721 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	54,313,016 - 54,317,611 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

CXCL16
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	4,733,533 - 4,739,928 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	4,733,533 - 4,739,934 (-)	Ensembl			hg38	GRCh38
GRCh37	17	4,636,828 - 4,643,223 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	4,583,577 - 4,589,972 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	17	4,583,583 - 4,589,863	NCBI
Celera	17	4,652,030 - 4,658,426 (-)	NCBI		Celera
Cytogenetic Map	17	p13.2	NCBI
HuRef	17	4,525,914 - 4,531,582 (-)	NCBI		HuRef
CHM1_1	17	4,645,559 - 4,651,953 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	4,623,202 - 4,629,598 (-)	NCBI		T2T-CHM13v2.0

Cxcl16
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	70,345,215 - 70,350,810 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	70,344,809 - 70,350,810 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	70,454,389 - 70,459,984 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	70,453,983 - 70,459,984 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	70,267,736 - 70,273,486 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	70,270,429 - 70,276,179 (-)	NCBI		MGSCv36	mm8
Celera	11	78,000,199 - 78,005,953 (-)	NCBI		Celera
Cytogenetic Map	11	B3	NCBI
cM Map	11	42.99	NCBI

Cxcl16
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955467	10,132,544 - 10,136,239 (-)	Ensembl
ChiLan1.0	NW_004955467	10,132,461 - 10,136,649 (-)	NCBI	ChiLan1.0	ChiLan1.0

CXCL16
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	12,351,100 - 12,357,230 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	14,319,363 - 14,325,829 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	4,789,280 - 4,795,656 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	4,778,717 - 4,785,639 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	4,778,717 - 4,785,639 (-)	Ensembl			panPan2	panpan1.1

CXCL16
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	31,816,889 - 31,820,975 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	31,816,667 - 31,820,840 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	31,955,979 - 31,960,601 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	31,921,756 - 31,926,380 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	31,921,953 - 31,925,916 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	31,888,075 - 31,892,688 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	31,847,757 - 31,852,370 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	32,023,989 - 32,028,615 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cxcl16
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	52,738,369 - 52,743,825 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936677	3,157,144 - 3,163,210 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936677	3,157,173 - 3,162,599 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CXCL16
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	12	52,145,100 - 52,150,267 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	54,264,331 - 54,269,485 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CXCL16
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	4,214,823 - 4,220,339 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	4,211,621 - 4,219,789 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666059	17,420,672 - 17,426,403 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cxcl16
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624786	8,589,687 - 8,594,059 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cxcl16
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	50,065,268 - 50,069,764 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cxcl16
14 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	266
Count of miRNA genes:	173
Interacting mature miRNAs:	198
Transcripts:	ENSRNOT00000032926
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35893451	64140567	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	51071897	96071897	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	36211556	69161158	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	47489017	69161158	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15776754	60776754	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	27443787	72443787	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	52162433	75582749	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
1578762	Toxo1	Toxoplasma gondii resistance QTL 1			brain integrity trait (VT:0010579)	percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028)	10	52699004	59876693	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	19939207	64939207	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	18035782	63035782	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	54296336	99451733	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41831278	86831278	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50464802	95464802	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44939359	89939359	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45529164	96099749	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18668419	63668419	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21833758	61843633	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50860288	95860288	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28950353	73950353	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35893263	64653589	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29800910	64653589	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	27443787	72443787	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42823274	87823274	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44939359	89939359	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42823274	87823274	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	54296227	67476781	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	49495492	94495492	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
1354585	Eae18a	Experimental allergic encephalomyelitis QTL 18a	7.5	0.0004	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	54296227	58944345	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	14653541	59653541	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	27023535	61843633	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
2298495	Eae23	Experimental allergic encephalomyelitis QTL 23	16.93		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis duration (CMO:0001424)	10	16175525	61175525	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	20110614	65110614	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	29076978	74076978	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	55307972	93608131	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	18035782	63035782	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	43608793	88608793	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	27443787	72443787	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49943710	94943710	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44939359	89939359	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47869129	92869129	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
12880050	Am10	Aortic mass QTL 10		0.016	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	39503487	84503487	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50604677	95604677	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	20110614	65110614	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

RH129630

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	55,166,724 - 55,166,927 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	57,060,009 - 57,060,211	NCBI	Rnor6.0
Rnor_5.0	10	56,817,246 - 56,817,448	UniSTS	Rnor5.0
RGSC_v3.4	10	57,296,130 - 57,296,332	UniSTS	RGSC3.4
Celera	10	54,313,020 - 54,313,222	UniSTS
RH 3.4 Map	5	451.1	UniSTS
Cytogenetic Map	10	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001017478	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC079312	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ025528	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855531	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855532	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855534	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855535	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855536	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855537	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855538	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855539	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855540	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855542	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855543	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855545	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855546	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855549	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN855550	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y17324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000032926 ⟹ ENSRNOP00000037160

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	55,664,742 - 55,670,226 (-)	Ensembl
mRatBN7.2 Ensembl	10	55,166,723 - 55,171,316 (-)	Ensembl
Rnor_6.0 Ensembl	10	57,060,007 - 57,064,600 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118669 ⟹ ENSRNOP00000084149

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	55,665,272 - 55,670,226 (-)	Ensembl
mRatBN7.2 Ensembl	10	55,166,844 - 55,171,592 (-)	Ensembl

RefSeq Acc Id:

NM_001017478 ⟹ NP_001017478

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	55,665,355 - 55,669,950 (-)	NCBI
mRatBN7.2	10	55,166,721 - 55,171,316 (-)	NCBI
Rnor_6.0	10	57,060,005 - 57,064,600 (-)	NCBI
Rnor_5.0	10	56,817,242 - 56,821,837 (-)	NCBI
RGSC_v3.4	10	57,296,126 - 57,300,721 (-)	RGD
Celera	10	54,313,016 - 54,317,611 (-)	RGD

Sequence:

show sequence

CCAGGAGTCTCGAGTCGGAAGGAGCTCCGCCTTCCGGGGCAGGGATGTGTGTGTCCCCCGACTG
GGAGCTGGGCGCAGCGCGGGCTCCCCGGTACTGACCAGACGGTCGGTTCAGGACAGCGCGCGGG
GGACAGAAGGCGCCACCACCTCGCGCCCCCTCCCTTCCTGAGCTTGGCACAGATCAGCGCCTCC
GCAAAGCATCAGCCAGGGTGAAGTGAAAGCAATAGAGAATCTGCTGGATGTCGGCTAGGTGACC
TGGCCTCAACAAGCTCCGCAGCGGCCTGAGATGAGGCGGGGCTTTGGACCCTTGGCCCTTACAC
TCTTCCTTTTCTTCTTTGCGCTGCTGACTCTGCCAGGCGATGGCAACCAGGGCAGTGTCGCTGG
AAGTTGCTACTGTGATCGTACAATTCCTTCTGGCACCCAGATACCGCCTGCTACTTTGAATCAT
ATGCGAAAATATCTGAAAACGTTCCATCGCTGTCAATTCTTTATCAGGTTCCAGTTGCAGTCCA
AGAGTGTGTGTGGAGGAAGCCAAGACCAGTGGGTCCGTGAACTAGTGAACTGCTTTGAGCACAA
ACAATGTGGAATCGGTCATGGGCAGAGTTTTCACCACCAAAAACATGTGCCTCAAGCCAGTACC
CGGATCCCTGAGGCCACAGAAGGGAAACCTCCAGACACAAGCACGGCTGTACAGTTTCAGAGCA
CCCAGCAGTCCACTTTTCCATCTGGAGCACCATCCTTGAACAAAGAGCTCACCCGCCACTGGGA
AACAACCATTCTCCCTTCAGGCTATGGTCTGGAGGCTAGGCCTGTGGCTGAGGCAAATGAGAAA
CAGCACAAACAGCAAAAAGAACCAGGAGCTGGTGCTGGCACACAAGCCTTGGTGCCGGTGCTAT
CCCTCCTGGCCATCGTCTTCTTCCTCGTGGCAGCCATGGTCTGTGTGCTGTGCAACAGGAGAGT
GACTCGGCAGAGCTCTTCAGGTTTGCAGCTCTGTTATACACCTGTTGAACCAAGACCCCAGGGC
CTGTAGCAAGAATGGAAGCTCGTGAGAGATGATGTGGGAGAGGTGGCAGACAGACTGGCAGGCT
AGGCTCCATCAACGAACTGAATCTGAGCTCATTTTTTCTGGTGATGTTTTGAATCAAAGTAGCC
ATTATGTAATCTAGGACAGCTTTGAACTACAGAGCCTGTGCCCCGACCTCCTAGATTCTGGGAT
TATAGATATATCCTACTGCATCTGCCCTCGTCTACTTTCATAAATAAGGTATAAATTTTCAGGT
TTTTGTTTTGTTTAGCGAAGATCTTATTTAGCCCAAGCCAACCTCAAATTCCCTATGTATCTCT
AGGTCCCCTGCCTCCTTACACACTCACTAAACGCTTTTCTTTTTGGTTTGTTTGAGACAGGGTT
TCACTATTCAGCCTTGACAGTCCTAGAACTCAGAAAGGTCTGCCTTTCTGCAGTGTTGGGATTA
AAGGACTGCCCTTGGGAAACCCTCTTTACAACTAATAACATCTGCATAGCCCCTCTGCCCTAGC
CTTTCCCCTGCCTCTAATAAAATGTAATACTCTCAAGTATGTGGTCCAAAAGTGCAGTCAGAGG
TGGAGTGTAAAGTTCGAGGTTCAACCTGCCCATTAACAGATTAATTTTAAAAAGTGTCTGCTTT
TTACATTGTGTAACAATAAACTGGACAAATTCTATGTTTTTAAAAAAAAAAAAAAAAAAAAAAA
AA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001017478	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH79312	(Get FASTA)	NCBI Sequence Viewer
	AAY42602	(Get FASTA)	NCBI Sequence Viewer
	EDM05006	(Get FASTA)	NCBI Sequence Viewer
	EDM05007	(Get FASTA)	NCBI Sequence Viewer
	EDM05008	(Get FASTA)	NCBI Sequence Viewer
	EDM05009	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000037160.4
	ENSRNOP00000084149
GenBank Protein	Q6AXU5	(Get FASTA)	NCBI Sequence Viewer
	QJQ49351	(Get FASTA)	NCBI Sequence Viewer
	QJQ49352	(Get FASTA)	NCBI Sequence Viewer
	QJQ49353	(Get FASTA)	NCBI Sequence Viewer
	QJQ49354	(Get FASTA)	NCBI Sequence Viewer
	QJQ49355	(Get FASTA)	NCBI Sequence Viewer
	QJQ49356	(Get FASTA)	NCBI Sequence Viewer
	QJQ49357	(Get FASTA)	NCBI Sequence Viewer
	QJQ49358	(Get FASTA)	NCBI Sequence Viewer
	QJQ49359	(Get FASTA)	NCBI Sequence Viewer
	QJQ49360	(Get FASTA)	NCBI Sequence Viewer
	QJQ49361	(Get FASTA)	NCBI Sequence Viewer
	QJQ49362	(Get FASTA)	NCBI Sequence Viewer
	QJQ49363	(Get FASTA)	NCBI Sequence Viewer
	QJQ49364	(Get FASTA)	NCBI Sequence Viewer
	QJQ49365	(Get FASTA)	NCBI Sequence Viewer
	QJQ49366	(Get FASTA)	NCBI Sequence Viewer
	QJQ49367	(Get FASTA)	NCBI Sequence Viewer
	QJQ49368	(Get FASTA)	NCBI Sequence Viewer
	QJQ49369	(Get FASTA)	NCBI Sequence Viewer
	QJQ49370	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001017478 ⟸ NM_001017478
- Peptide Label:	precursor
- UniProtKB:	Q6AXU5 (UniProtKB/Swiss-Prot), A0A6M4C4P9 (UniProtKB/TrEMBL), A0A6M4C4V5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRRGFGPLALTLFLFFFALLTLPGDGNQGSVAGSCYCDRTIPSGTQIPPATLNHMRKYLKTFHR CQFFIRFQLQSKSVCGGSQDQWVRELVNCFEHKQCGIGHGQSFHHQKHVPQASTRIPEATEGKP PDTSTAVQFQSTQQSTFPSGAPSLNKELTRHWETTILPSGYGLEARPVAEANEKQHKQQKEPGA GAGTQALVPVLSLLAIVFFLVAAMVCVLCNRRVTRQSSSGLQLCYTPVEPRPQGL hide sequence

Ensembl Acc Id:

ENSRNOP00000037160 ⟸ ENSRNOT00000032926

Ensembl Acc Id:

ENSRNOP00000084149 ⟸ ENSRNOT00000118669

Protein Domains

C-X-C motif chemokine

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6AXU5-F1-model_v2	AlphaFold	Q6AXU5	1-247	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697359

Promoter ID:

EPDNEW_R7883

Type:

initiation region

Name:

Cxcl16_1

Description:

C-X-C motif chemokine ligand 16

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	57,064,560 - 57,064,620	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562928	AgrOrtholog
BioCyc Gene	G2FUF-24460	BioCyc
Ensembl Genes	ENSRNOG00000026647	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000032926.5	UniProtKB/Swiss-Prot
	ENSRNOT00000118669	ENTREZGENE
IMAGE_CLONE	IMAGE:7134808	IMAGE-MGC_LOAD
InterPro	CXCL16	UniProtKB/Swiss-Prot
	CXCL16_dom	UniProtKB/Swiss-Prot
KEGG Report	rno:497942	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94457	IMAGE-MGC_LOAD
NCBI Gene	497942	ENTREZGENE
PANTHER	C-X-C MOTIF CHEMOKINE 16	UniProtKB/Swiss-Prot
	PTHR14385	UniProtKB/Swiss-Prot
Pfam	CXCL16	UniProtKB/Swiss-Prot
PhenoGen	Cxcl16	PhenoGen
RatGTEx	ENSRNOG00000026647	RatGTEx
UniProt	A0A6M4C4D5_RAT	UniProtKB/TrEMBL
	A0A6M4C4E8_RAT	UniProtKB/TrEMBL
	A0A6M4C4F8_RAT	UniProtKB/TrEMBL
	A0A6M4C4I0_RAT	UniProtKB/TrEMBL
	A0A6M4C4M1_RAT	UniProtKB/TrEMBL
	A0A6M4C4P9	ENTREZGENE, UniProtKB/TrEMBL
	A0A6M4C4Q4_RAT	UniProtKB/TrEMBL
	A0A6M4C4S4_RAT	UniProtKB/TrEMBL
	A0A6M4C4V5	ENTREZGENE, UniProtKB/TrEMBL
	A0A6M4C538_RAT	UniProtKB/TrEMBL
	A0A6M4C545_RAT	UniProtKB/TrEMBL
	A0A6M4C548_RAT	UniProtKB/TrEMBL
	A0A8I6GBI0_RAT	UniProtKB/TrEMBL
	A6HG51_RAT	UniProtKB/TrEMBL
	CXL16_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-08	Cxcl16	C-X-C motif chemokine ligand 16	Cxcl16	chemokine (C-X-C motif) ligand 16	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-03	Cxcl16	chemokine (C-X-C motif) ligand 16	Cxcl16	similar to chemokine (C-X-C motif) ligand 16	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	Cxcl16	similar to chemokine (C-X-C motif) ligand 16			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)