Advanced Search (OLGA)

Gene: Faxc (failed axon connections homolog, metaxin like GST domain containing) Rattus norvegicus

Analyze

Symbol:

Faxc

Name:

failed axon connections homolog, metaxin like GST domain containing

RGD ID:

1562449

Description:

Predicted to be located in membrane. Predicted to be active in cytoplasm. Orthologous to human FAXC (failed axon connections homolog, metaxin like GST domain containing); INTERACTS WITH 17alpha-ethynylestradiol; 4,4'-sulfonyldiphenol; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

failed axon connections; failed axon connections homolog; failed axon connections homolog (Drosophila); LOC366333; RGD1562449; similar to hypothetical protein MGC2817

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FAXC (failed axon connections homolog, metaxin like GST domain containing)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Faxc (failed axon connections homolog)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Faxc (failed axon connections homolog, metaxin like GST domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FAXC (failed axon connections homolog, metaxin like GST domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FAXC (failed axon connections homolog, metaxin like GST domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Faxc (failed axon connections homolog, metaxin like GST domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FAXC (failed axon connections homolog, metaxin like GST domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Faxc (failed axon connections homolog, metaxin like GST domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Faxc (failed axon connections homolog, metaxin like GST domain containing)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	FAXC (failed axon connections homolog, metaxin like GST domain containing)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Faxc (failed axon connections homolog)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	faxca (failed axon connections homolog, metaxin like GST domain containing a)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	faxcb (failed axon connections homolog, metaxin like GST domain containing b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C25H3.7	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	Y48C3A.3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y48C3A.3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	fax	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y57A10A.26	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y57A10A.26	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cdr-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	cdr-2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	cdr-2	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	cdr-3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	cdr-4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	cdr-6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	cdr-7	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	hrg-2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	arf3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	faxc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	faxc	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	wdr86	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	40,277,167 - 40,336,503 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	40,277,135 - 40,344,076 (+)	Ensembl				GRCr8
mRatBN7.2	5	35,480,137 - 35,539,741 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	35,480,402 - 35,544,446 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	37,604,846 - 37,665,224 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	39,197,570 - 39,257,948 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	39,137,078 - 39,197,452 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	36,076,565 - 36,135,884 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	36,076,565 - 36,135,884 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	40,729,199 - 40,795,856 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	36,677,691 - 36,737,527 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	34,493,714 - 34,553,101 (+)	NCBI		Celera
Cytogenetic Map	5	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

prostate cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

4,4'-sulfonyldiphenol (EXP)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

bisphenol F (EXP)

butanal (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

D-glucose (ISO)

entinostat (ISO)

ethanol (ISO)

fructose (ISO)

gentamycin (EXP)

glucose (ISO)

ketamine (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

nickel atom (ISO)

nickel sulfate (ISO)

okadaic acid (ISO)

panobinostat (ISO)

pentanal (ISO)

perfluorooctanoic acid (EXP)

propionic acid (ISO)

sodium arsenite (ISO)

streptozocin (ISO)

sunitinib (ISO)

temozolomide (ISO)

testosterone (ISO)

thiram (ISO)

trichloroethene (EXP)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

membrane (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Faxc
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	40,277,167 - 40,336,503 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	40,277,135 - 40,344,076 (+)	Ensembl				GRCr8
mRatBN7.2	5	35,480,137 - 35,539,741 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	35,480,402 - 35,544,446 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	37,604,846 - 37,665,224 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	39,197,570 - 39,257,948 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	39,137,078 - 39,197,452 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	36,076,565 - 36,135,884 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	36,076,565 - 36,135,884 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	40,729,199 - 40,795,856 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	36,677,691 - 36,737,527 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	34,493,714 - 34,553,101 (+)	NCBI		Celera
Cytogenetic Map	5	q21	NCBI

FAXC
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	99,271,161 - 99,350,056 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	99,271,168 - 99,350,062 (-)	Ensembl			hg38	GRCh38
GRCh37	6	99,719,037 - 99,797,932 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	99,835,257 - 99,904,252 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	99,835,257 - 99,904,252	NCBI
Celera	6	100,364,951 - 100,441,701 (-)	NCBI		Celera
Cytogenetic Map	6	q16.2	NCBI
HuRef	6	97,160,917 - 97,237,940 (-)	NCBI		HuRef
CHM1_1	6	99,983,861 - 100,060,596 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	100,445,536 - 100,524,422 (-)	NCBI		T2T-CHM13v2.0

Faxc
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	21,930,906 - 22,001,461 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	21,931,329 - 21,996,839 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	21,930,906 - 22,001,461 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	21,931,329 - 21,996,839 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	21,858,473 - 21,928,608 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	22,022,168 - 22,041,724 (+)	NCBI		MGSCv36	mm8
Celera	4	21,684,171 - 21,753,905 (+)	NCBI		Celera
Cytogenetic Map	4	A3	NCBI
cM Map	4	9.2	NCBI

Faxc
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955411	25,154,311 - 25,220,334 (-)	Ensembl
ChiLan1.0	NW_004955411	25,154,311 - 25,220,334 (-)	NCBI	ChiLan1.0	ChiLan1.0

FAXC
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	119,319,173 - 119,396,464 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	117,200,253 - 117,277,721 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	97,113,378 - 97,190,850 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	100,996,013 - 101,072,924 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	101,004,265 - 101,072,924 (-)	Ensembl			panPan2	panpan1.1

FAXC
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	57,493,062 - 57,571,489 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	57,501,170 - 57,570,563 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	57,251,342 - 57,329,397 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	58,314,401 - 58,392,753 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	58,322,504 - 58,391,886 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	57,673,975 - 57,752,343 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	57,524,232 - 57,596,260 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	57,769,177 - 57,841,438 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Faxc
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	92,439,355 - 92,509,728 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936651	902,301 - 964,447 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936651	900,932 - 965,188 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FAXC
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	74,525,175 - 74,596,948 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	74,525,691 - 74,594,703 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	46,856,937 - 46,932,497 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Faxc
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624810	5,700,087 - 5,773,484 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624810	5,699,612 - 5,773,816 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Faxc
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	121,352,393 - 121,414,115 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Faxc
427 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	112
Count of miRNA genes:	89
Interacting mature miRNAs:	98
Transcripts:	ENSRNOT00000013599
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293666	Bmd38	Bone mineral density QTL 38	4.4		femur size trait (VT:1000369)	femoral neck cortical cross-sectional area (CMO:0001702)	5	13731153	43590997	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	32751649	77751649	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	38011670	83011670	Rat
6907115	Mcs29	Mammary carcinoma susceptibility QTL 29			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	38004331	83004331	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	23671493	79046465	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1300117	Hrtrt8	Heart rate QTL 8	3.49		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	8627230	52665523	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	17576633	62576633	Rat
1578774	Tcas8	Tongue tumor susceptibility QTL 8	3.47		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	15707451	60707451	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	38011670	83011670	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	38011670	83011670	Rat
1331782	Rf36	Renal function QTL 36	3.296		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	39019942	102105896	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	33311673	78311673	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	32751649	77751649	Rat
1549901	Neudeg2	Neurodegradation QTL 2	4	0	nervous system integrity trait (VT:0010566)	mononuclear cell count (CMO:0002119)	5	31130421	48841739	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	17486080	62486080	Rat
2313085	Bss59	Bone structure and strength QTL 59	2.9	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	5	8627230	53627230	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	39985948	84985948	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	6922282	81330203	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33311673	78311673	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	39526924	84526924	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	14606078	59606078	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	91770353	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	7065535	74335773	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1641903	Alcrsp3	Alcohol response QTL 3			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	17486080	62486080	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	87027358	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	26023211	71023211	Rat
2303577	Gluco47	Glucose level QTL 47	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	16520019	61520019	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	23671493	68671493	Rat

Markers in Region

D5Arb16

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	35,488,608 - 35,488,977 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	36,084,771 - 36,085,139	NCBI	Rnor6.0
Rnor_5.0	5	40,737,515 - 40,737,883	UniSTS	Rnor5.0
RGSC_v3.4	5	36,694,037 - 36,694,401	UniSTS	RGSC3.4
RGSC_v3.4	5	36,685,897 - 36,686,265	UniSTS	RGSC3.4
Celera	5	34,501,921 - 34,502,285	UniSTS
Cytogenetic Map	5	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	12	66	140	70	69	38	35	38	6	259	134	10	119	64	92	31	14	14

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001271065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013599 ⟹ ENSRNOP00000013599

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	40,277,135 - 40,337,237 (+)	Ensembl
mRatBN7.2 Ensembl	5	35,480,402 - 35,539,741 (+)	Ensembl
Rnor_6.0 Ensembl	5	36,076,565 - 36,135,884 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111247 ⟹ ENSRNOP00000096428

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	35,480,402 - 35,544,446 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000127046 ⟹ ENSRNOP00000104533

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	40,277,135 - 40,344,076 (+)	Ensembl

RefSeq Acc Id:

NM_001271065 ⟹ NP_001257994

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	40,277,167 - 40,336,503 (+)	NCBI
mRatBN7.2	5	35,480,402 - 35,539,741 (+)	NCBI
Rnor_6.0	5	36,076,565 - 36,135,884 (+)	NCBI
Rnor_5.0	5	40,729,199 - 40,795,856 (+)	NCBI
Celera	5	34,493,714 - 34,553,101 (+)	NCBI

Sequence:

show sequence

CCGCTGCCTCGCCGGGCCTCAGGGCCCCGTCAGCCCGGCTCTCCGCTCGCCACCGGCGCCCTTC
CACTACCGCCTCCGCCTGCGCCCCCTGCGCACCGTTGAGCCCGCCTGCCCGGGCGCCGGCCCCT
TCCCATGCGGGCGGCGCGGGCCCTGGGAGGGGCGCCCGGAGCCAGCCGCGCAGCATGCACTGGG
GGGTTGGCTTTGCCTCGTCCAGGCCGTGCGTGGTGGACCTGAGCTGGAACCAGAGCATCTCCTT
CTTCGGCTGGTGGGCCGGGTCCGAGGAGCCCTTCTCCTTTTATGGGGACATCATCGCTTTCCCT
TTGCAGGATTACGGTGGGATCATGGCAGGGCTGGGCTCGGATCCCTGGTGGAAGAAAACCCTTT
ATTTGACCGGGGGAGCTTTGCTGGCCGCGGCTGCGTATCTGCTCCACGAACTCCTGGTCATTAG
GAAGCAGCAAGAGCTCGACTCCAAAGACGCCATTATTTTGCATCAGTTTGCAAGACCTAACAAT
GGTGTCCCCAGCTTGTCTCCTTTCTGTTTGAAAATGGAAACTTACTTAAGAATGGCCGACCTTC
CCTATCAGAACTATTTTGGTGGAAAACTCTCTGCTCAAGGGAAAATGCCTTGGATTGAATATAA
TAATGAAAAAGTGTCTGGCACAGAATTCATAATCGACTTTCTGGAAGAGAAACTTGGAGTGAAC
TTAAACAAAAACCTTGGCCCCCATGAAAGAGCTGTCTCAAGAGCTGTGACCAAGATGGTGGAAG
AGCACTTTTACTGGACATTAGCTTATTGCCAGTGGGTGGACAATCTCAATGAGACCCGGAAGAT
GCTGTCACTTAGTGGTGGTGGTCCCTTCAGTAACCTGCTCAGGTGGGTCGTGTGCCACATAACA
AAAGGAATTGTGAAGCGGGAGATGCACGGCCACGGCATTGGCCGCTTCTCGGAGGAAGAGATTT
ACATGCTGATGGAGAAGGACATGCGGTCTTTAGCAGGGCTTTTGGGTGACAAGAAGTACATCAT
GGGGCCCAAGCTTTCCACTCTTGATGCCACTGTCTTTGGACACTTGGCACAGGCGATGTGGACC
TTGCCAGGGACAAGACCGGAGCGGCTAATCAAAGGTGAGCTGATCAACCTTGCCATGTACTGCG
AGAGGATCAGGAGGAAATTCTGGCCCGAATGGCACCATGACGATGACAACACCATCTATGAGTC
TGAGGAGAGCAGCGAGGGCAGCAAGACTCACACACCTATGCTGGATTTTAGCTTTTACTCAAGG
ACAGAGACCTTTGAAGATGAGGGGGCTGAGAACAGTTTTTCCAGGACCCCAGACACGGATTTCA
CCGGACATTCTCTCTTTGACTCTGACGTGGACATGGATGACTACACAGAACACGAACAGTGCAA
ATGATGCCCCATCATGGACCATCTTCCTCAGGAGTCAGCATTCCCTGGGGTCGGTCTGGTTTCC
CAGATAGAAATCCATCTGAGCTGGGAGGAGATCTTCAAGCCTGGCCCAGTTTCAACATACCAAC
TGGACTATAAACCGCCTTATTTCCTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTTT
TTTTTTTTTGTACAAACAGAAATACAGAACCATTCAGATGGCTCCGTCTAAAACAGACAAAACA
AATATCAGCATGGTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001257994	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D3ZAT9	(Get FASTA)	NCBI Sequence Viewer
	EDL98526	(Get FASTA)	NCBI Sequence Viewer
	EDL98527	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013599.5
	ENSRNOP00000104533

RefSeq Acc Id:

NP_001257994 ⟸ NM_001271065

- UniProtKB:

D3ZAT9 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MHWGVGFASSRPCVVDLSWNQSISFFGWWAGSEEPFSFYGDIIAFPLQDYGGIMAGLGSDPWWK
KTLYLTGGALLAAAAYLLHELLVIRKQQELDSKDAIILHQFARPNNGVPSLSPFCLKMETYLRM
ADLPYQNYFGGKLSAQGKMPWIEYNNEKVSGTEFIIDFLEEKLGVNLNKNLGPHERAVSRAVTK
MVEEHFYWTLAYCQWVDNLNETRKMLSLSGGGPFSNLLRWVVCHITKGIVKREMHGHGIGRFSE
EEIYMLMEKDMRSLAGLLGDKKYIMGPKLSTLDATVFGHLAQAMWTLPGTRPERLIKGELINLA
MYCERIRRKFWPEWHHDDDNTIYESEESSEGSKTHTPMLDFSFYSRTETFEDEGAENSFSRTPD
TDFTGHSLFDSDVDMDDYTEHEQCK

hide sequence

Ensembl Acc Id:

ENSRNOP00000013599 ⟸ ENSRNOT00000013599

Ensembl Acc Id:

ENSRNOP00000096428 ⟸ ENSRNOT00000111247

Ensembl Acc Id:

ENSRNOP00000104533 ⟸ ENSRNOT00000127046

Protein Domains

Failed axon connections homolog N-terminal Metaxin glutathione S-transferase Thioredoxin-like fold

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZAT9-F1-model_v2	AlphaFold	D3ZAT9	1-409	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693599

Promoter ID:

EPDNEW_R4124

Type:

single initiation site

Name:

Faxc_1

Description:

failed axon connections homolog

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	36,076,520 - 36,076,580	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562449	AgrOrtholog
BioCyc Gene	G2FUF-41809	BioCyc
Ensembl Genes	ENSRNOG00000010106	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000013599.7	UniProtKB/Swiss-Prot
	ENSRNOT00000127046	ENTREZGENE
InterPro	FAX	UniProtKB/Swiss-Prot
	FAXC_N	UniProtKB/Swiss-Prot
	Glutathione-S-Trfase_C_sf	UniProtKB/Swiss-Prot
	Glutathione_S-Trfase	UniProtKB/Swiss-Prot
	Metaxin_GST	UniProtKB/Swiss-Prot
	Mito_Protein_Transport_Metaxin	UniProtKB/Swiss-Prot
	Thioredoxin-like_fold	UniProtKB/Swiss-Prot
	Thioredoxin-like_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:366333	UniProtKB/Swiss-Prot
NCBI Gene	366333	ENTREZGENE
PANTHER	FAILED AXON CONNECTIONS HOMOLOG	UniProtKB/Swiss-Prot
	METAXIN RELATED	UniProtKB/Swiss-Prot
Pfam	FAXC_N	UniProtKB/Swiss-Prot
	GST_C_6	UniProtKB/Swiss-Prot
	GST_N_4	UniProtKB/Swiss-Prot
PhenoGen	Faxc	PhenoGen
RatGTEx	ENSRNOG00000010106	RatGTEx
Superfamily-SCOP	SSF47616	UniProtKB/Swiss-Prot
	SSF52833	UniProtKB/Swiss-Prot
UniProt	A6IIF6_RAT	UniProtKB/TrEMBL
	D3ZAT9	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-04-10	Faxc	failed axon connections homolog, metaxin like GST domain containing	Faxc	failed axon connections homolog	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-06-17	Faxc	failed axon connections homolog	Faxc	failed axon connections homolog (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-10-17	Faxc	failed axon connections homolog (Drosophila)	Faxc	failed axon connections	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-10-11	Faxc	failed axon connections	RGD1562449	similar to hypothetical protein MGC2817	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1562449	similar to hypothetical protein MGC2817	RGD1562449_predicted	similar to hypothetical protein MGC2817 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1562449_predicted	similar to hypothetical protein MGC2817 (predicted)	LOC366333	similar to hypothetical protein MGC2817	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC366333	similar to hypothetical protein MGC2817			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar