Advanced Search (OLGA)

Gene: St6galnac1 (ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1) Rattus norvegicus

Analyze

Symbol:

St6galnac1

Name:

ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1

RGD ID:

1562048

Description:

Predicted to enable alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity. Predicted to be involved in host-mediated modulation of intestinal microbiota composition; oligosaccharide biosynthetic process; and protein glycosylation. Predicted to be located in Golgi apparatus and membrane. Predicted to be active in Golgi membrane. Orthologous to human ST6GALNAC1 (ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1); PARTICIPATES IN O-linked glycan biosynthetic pathway; INTERACTS WITH atrazine; bisphenol A; trichloroethene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

alpha-2,6-sialyltransferase ST6GalNAc I; alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1; sialyltransferase 7 ((alpha-N-acetylneuraminyl 2,3-beta-galactosyl-1,3)-N-acetyl galactosaminde alpha-2,6-sialyltransferase) A; Siat7A; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1; ST6 GalNAc alpha-2,6-sialyltransferase 1; ST6GALNAC1, alpha-2,6-sialyltransferase 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	102,471,481 - 102,481,876 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	102,471,493 - 102,481,876 (-)	Ensembl				GRCr8
mRatBN7.2	10	101,972,656 - 101,983,053 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	101,972,668 - 101,983,053 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	107,079,707 - 107,090,110 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	106,542,789 - 106,553,192 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	101,893,516 - 101,903,911 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	105,713,305 - 105,723,700 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	105,713,317 - 105,723,700 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	105,374,445 - 105,384,844 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	106,837,311 - 106,881,619 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	100,544,188 - 100,554,583 (-)	NCBI		Celera
Cytogenetic Map	10	q32.2	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

inflammatory bowel disease (ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

acrolein (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP)

cadmium dichloride (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

chrysene (ISO)

clofibrate (ISO)

dorsomorphin (ISO)

enzalutamide (ISO)

folic acid (ISO)

graphene oxide (ISO)

lead diacetate (ISO)

lead(0) (ISO)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

paracetamol (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

progesterone (ISO)

propanal (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

testosterone (ISO)

tetraphene (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triclosan (ISO)

triptonide (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

glycoprotein biosynthetic process (IEA,ISO)

host-mediated modulation of intestinal microbiota composition (IBA,ISO)

host-mediated perturbation of symbiont process (ISO)

oligosaccharide biosynthetic process (IBA,ISO)

Cellular Component

Golgi membrane (IBA,IEA,ISO)

Molecular Function

alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity (IBA,IEA,ISO)

glycosyltransferase activity (IEA)

protein binding (ISO)

sialyltransferase activity (IEA)

transferase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

O-linked glycan biosynthetic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10788794	PMID:15843597	PMID:30854566

Genomics

Comparative Map Data

St6galnac1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	102,471,481 - 102,481,876 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	102,471,493 - 102,481,876 (-)	Ensembl				GRCr8
mRatBN7.2	10	101,972,656 - 101,983,053 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	101,972,668 - 101,983,053 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	107,079,707 - 107,090,110 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	106,542,789 - 106,553,192 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	101,893,516 - 101,903,911 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	105,713,305 - 105,723,700 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	105,713,317 - 105,723,700 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	105,374,445 - 105,384,844 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	106,837,311 - 106,881,619 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	100,544,188 - 100,554,583 (-)	NCBI		Celera
Cytogenetic Map	10	q32.2	NCBI

ST6GALNAC1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	76,617,407 - 76,643,757 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	76,624,756 - 76,643,812 (-)	Ensembl			hg38	GRCh38
GRCh37	17	74,620,845 - 74,639,839 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	72,132,440 - 72,151,489 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	17	72,132,441 - 72,151,327	NCBI
Celera	17	71,213,224 - 71,232,267 (-)	NCBI		Celera
Cytogenetic Map	17	q25.1	NCBI
HuRef	17	70,048,336 - 70,067,435 (-)	NCBI		HuRef
CHM1_1	17	74,685,839 - 74,704,894 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	77,513,932 - 77,540,529 (-)	NCBI		T2T-CHM13v2.0

St6galnac1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	116,655,851 - 116,666,333 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	116,655,851 - 116,666,333 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	116,765,025 - 116,775,507 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	116,765,025 - 116,775,507 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	116,626,339 - 116,636,821 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	116,581,115 - 116,591,597 (-)	NCBI		MGSCv36	mm8
Celera	11	128,478,824 - 128,520,872 (-)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	81.49	NCBI

St6galnac1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955506	5,656,176 - 5,677,614 (+)	Ensembl
ChiLan1.0	NW_004955506	5,656,182 - 5,677,596 (+)	NCBI	ChiLan1.0	ChiLan1.0

ST6GALNAC1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	92,668,358 - 92,693,706 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	97,493,720 - 97,519,466 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	70,705,223 - 70,721,046 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	76,263,305 - 76,288,115 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	76,263,877 - 76,287,941 (-)	Ensembl			panPan2	panpan1.1

ST6GALNAC1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	4,098,881 - 4,124,417 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	4,101,050 - 4,123,896 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	4,782,442 - 4,805,244 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	4,774,895 - 4,800,385 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	4,777,043 - 4,800,178 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	4,802,574 - 4,825,137 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	4,922,238 - 4,945,012 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	5,003,369 - 5,026,130 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

St6galnac1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	4,698,944 - 4,721,193 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	1,690,769 - 1,711,982 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	1,690,799 - 1,711,940 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ST6GALNAC1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	4,890,406 - 4,909,351 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	4,889,852 - 4,909,345 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	4,742,080 - 4,760,387 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ST6GALNAC1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	45,020,465 - 45,057,403 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	45,038,943 - 45,057,615 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666077	15,778,125 - 15,797,400 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

St6galnac1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	6,478,910 - 6,499,959 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624801	6,478,153 - 6,500,047 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in St6galnac1
65 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	87
Count of miRNA genes:	77
Interacting mature miRNAs:	81
Transcripts:	ENSRNOT00000042321
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93723381	107556066	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	58073360	103073360	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68920187	107713808	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76951790	107713808	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
1300107	Rf18	Renal function QTL 18	3.41		urine output (VT:0003620)	timed urine volume (CMO:0000260)	10	79272424	102982300	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	73599825	107713808	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	89039175	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70698731	107713808	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	97202388	107556066	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87807758	107713808	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	76128947	107713808	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	91127270	107556066	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91727883	107713808	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	97202388	107556066	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	14	43	24	27	8	12	8	6	106	46	8	23	36	72	19	2	2

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ634458	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000042321 ⟹ ENSRNOP00000042177

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	102,471,493 - 102,481,876 (-)	Ensembl
mRatBN7.2 Ensembl	10	101,972,668 - 101,983,053 (-)	Ensembl
Rnor_6.0 Ensembl	10	105,713,317 - 105,723,700 (-)	Ensembl

RefSeq Acc Id:

NM_001105859 ⟹ NP_001099329

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	102,471,481 - 102,481,876 (-)	NCBI
mRatBN7.2	10	101,972,656 - 101,983,053 (-)	NCBI
Rnor_6.0	10	105,713,305 - 105,723,700 (-)	NCBI
Rnor_5.0	10	105,374,445 - 105,384,844 (-)	NCBI
RGSC_v3.4	10	106,837,311 - 106,881,619 (-)	RGD
Celera	10	100,544,188 - 100,554,583 (-)	RGD

Sequence:

show sequence

AAGGTCAGGGCTCCCTCACTCTCATCTGGACAAGGAGGTGACCTGCTACCTCAGGAGGCTCGCT
CATCACACGTGCGTTTGGGGGCCAGCCGCCCACCATGGAGAACCGTTGTAGAGGGCTTTCCCAG
GGGCAAACTTTCCTGCTTCTGACTGGGTTGATGTTGCTCTTTATCCTGCCCTCCGTTGTCAAGG
AGCCAAGCACAAGGGTTTCCAGGTACCAGTTTATAGAGGACAATGAATCAAGTCTGCAGGGGGT
TCCACAAAAGCCTGCACCCCAAGGACCCATCGTGACCCTGACACCCACAGTTCACAACAAGAAG
ACAACCTCTGTCAGGACAAAGTGGGTGGAGCTGCAGAAACAGGACAGAGCGACAGCCCGAGGAG
AGCGAGGAGAGGGGGTGGAGAAGAAGTTGCAAGCTATAAGGCTAGCACCAGAGAATCCTAAGGG
CAAGGCAGAACCTGAGGTAAAGACGCCTGCTTCAAAACATCTGGACAAACTACCAAGAGCTACA
GGAGCACTGTCAACAAGGAAGACACAAATGGCCACAGGAGCTGCCCCAGCCAAGAAGAAGGTGG
TCCAGCCCACCCCAACCCCTGCCTCTTTCCCACACCTCACCACACAAAGACGCCAAAGGTTGAA
GGCCTCCGACTTCAAGTCTGAGCCTCGGTGGGATTTTGAGGAGGAATATAGCTTGGATGGGGGC
AGCCTACAGACGACCTGCCCTGGCTCTGTGAAGATCACGGCTTCCCATTCACCATGGCTACAAA
ATATCTTTCTGCCCAACATCACTCTGTTCCTGGACTCTGGGCGCTTCAACCAGAGCGAGTGGTA
CAGGCTAGAGCACTTCACTCCACCCTTCGGCTTCATGGAGCTCAATCAGTCCCTGGTACAGAAG
GTGGTGAGCCGCTTCCCTCCGGTACCCCAGCAGCAGCTCCTCCTTGCCAGCCTCCCCACTAGGA
ACTTGACGTGTATCACCTGTGCTGTAGTGGGCAACGGAGGCATCCTCAATAATTCACGTATGGG
CCAGGAGATAGACAGCCATGACTACGTCTTCCGACTGAGTGGAGCCGTTATTAAAGGATATGAA
CAGGATGTGGGGACCCGGACATCCTTCTATGGCTTCACTGCCTTCTCCCTGGTCCAGTCTATCC
TCAATTTGGGTCGTCAAGGTTTCCAGCATGTGCCTCTGGGGAAGGATGTCCGATATCTACACTT
CCTGGAAGGCACCCGGGACTATGAGTGGCTGGAAGCTATGTTCTTGAATCGGACCATGGCAAAT
ACTAAACTTTACTGGTTCAGGCATAGACCCCAGGAAGCCTTTAGAGAGGCCTTGGACTTGGATC
GATACTTTCTGGTACACCCAGACTTTCTCCGTTACATGAAGAACAGGTTTTTGAGGTCAAAGAC
CCTGGACACTGCCCACTGGAGACTATACCGCCCCACCACTGGTGCCCTCCTGCTGCTTACAGCC
CTTCATCTCTGTGACAAGGTGAGCGCCTATGGCTTCATCACCCAGGGCCACGAGCGCTTCTCTG
ATCACTACTATGATACATCGTGGAAACGGCTCATCTTTTACATAAACCATGACTTCGCGTTAGA
GAGAACGGTCTGGAAGAGGCTGCATGATGAAGGCATCATCCAGCTGTACCAGCGCCCGTAGAGT
GGCAAAGCAAAGAACTGACCAGGGCCTGGATCGAGGTTCCCCTCAATCACTTACAACAGGGGTG
TAAGGGTTCCTCAAATGCTCCTTCCTGTCTCCCAGACTCAAACCTGCTCCATGCCCTTCCAGAG
TCCCAAGGAACAGGTGTGCATGACAGAGGGTTTGGAGTCCTTTGGAAAATCACCACAGGCTCTG
GGCATTTCCTGCTCAAACCGCAGCCTTAGAAACAGAGCCAAACCCCAAACAATTTAGTCCACCT
TACTTTACTTTTCAAACACTGCCTTCAGAAATTTGGCCTCTGGAACGCAGAGTATCAGTAAAGC
CCAAATCGAGGTGCTTATTAGTGGGTGGAAGGAAAACAAAGCGAGATAAAAACCAACTTCATTT
AGATTTAGTGCCCAGTAGGGTACTATACTGCTTATGATTTGCTCAGACTGCAGTAGCGACTCCG
GCCGGCAGGGGGCGGCAGCTGGGCGCTCGAGAGCAGATTGACTTTTGCTTTGCTGGAGCAGCGC
TTCTGCAAGGTGGAGCCGGCCCAGCACTCAGGGTTCAGGGCTGAGCAGGATGAAGTCCAGGAGG
ACGCTGCAAGCTGAGCAGGACACGGATGGCTCAGGGGTTAAGAGCACATGCTGCTCTAGCAGAG
GACCTGAGTTTGGATCCCAGTGGCTATGTTACACAACGCTCAACTGCCTGTACACAGGTGATGT
CCTGGCTGGTTTTAGGTCAACTTGACATAGGATAGATATGAGACTTCAACTGAAAAAAATATGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099329	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAG25684	(Get FASTA)	NCBI Sequence Viewer
	EDM06692	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000042177
	ENSRNOP00000042177.3

RefSeq Acc Id:	NP_001099329 ⟸ NM_001105859
- Peptide Label:	precursor
- UniProtKB:	G3V9C4 (UniProtKB/TrEMBL), A6HKY7 (UniProtKB/TrEMBL), Q6ZYN7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MENRCRGLSQGQTFLLLTGLMLLFILPSVVKEPSTRVSRYQFIEDNESSLQGVPQKPAPQGPIV TLTPTVHNKKTTSVRTKWVELQKQDRATARGERGEGVEKKLQAIRLAPENPKGKAEPEVKTPAS KHLDKLPRATGALSTRKTQMATGAAPAKKKVVQPTPTPASFPHLTTQRRQRLKASDFKSEPRWD FEEEYSLDGGSLQTTCPGSVKITASHSPWLQNIFLPNITLFLDSGRFNQSEWYRLEHFTPPFGF MELNQSLVQKVVSRFPPVPQQQLLLASLPTRNLTCITCAVVGNGGILNNSRMGQEIDSHDYVFR LSGAVIKGYEQDVGTRTSFYGFTAFSLVQSILNLGRQGFQHVPLGKDVRYLHFLEGTRDYEWLE AMFLNRTMANTKLYWFRHRPQEAFREALDLDRYFLVHPDFLRYMKNRFLRSKTLDTAHWRLYRP TTGALLLLTALHLCDKVSAYGFITQGHERFSDHYYDTSWKRLIFYINHDFALERTVWKRLHDEG IIQLYQRP hide sequence

Ensembl Acc Id:

ENSRNOP00000042177 ⟸ ENSRNOT00000042321

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V9C4-F1-model_v2	AlphaFold	G3V9C4	1-520	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697923

Promoter ID:

EPDNEW_R8447

Type:

single initiation site

Name:

St6galnac1_1

Description:

ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	105,723,673 - 105,723,733	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562048	AgrOrtholog
BioCyc Gene	G2FUF-22583	BioCyc
Ensembl Genes	ENSRNOG00000000251	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000042321	ENTREZGENE
	ENSRNOT00000042321.7	UniProtKB/TrEMBL
Gene3D-CATH	3.90.1480.20	UniProtKB/TrEMBL
InterPro	Glyco_trans_29	UniProtKB/TrEMBL
	GT29-like_sf	UniProtKB/TrEMBL
KEGG Report	rno:287920	UniProtKB/TrEMBL
NCBI Gene	287920	ENTREZGENE
PANTHER	ALPHA-N-ACETYLGALACTOSAMINIDE ALPHA-2,6-SIALYLTRANSFERASE 1	UniProtKB/TrEMBL
	PTHR45941	UniProtKB/TrEMBL
Pfam	Glyco_transf_29	UniProtKB/TrEMBL
PhenoGen	St6galnac1	PhenoGen
RatGTEx	ENSRNOG00000000251	RatGTEx
UniProt	A6HKY7	ENTREZGENE, UniProtKB/TrEMBL
	G3V9C4	ENTREZGENE, UniProtKB/TrEMBL
	Q6ZYN7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-04	St6galnac1	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1	St6galnac1	ST6 GalNAc alpha-2,6-sialyltransferase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-04-27	St6galnac1	ST6 GalNAc alpha-2,6-sialyltransferase 1	St6galnac1	ST6GALNAC1, alpha-2,6-sialyltransferase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-04-13	St6galnac1	ST6GALNAC1, alpha-2,6-sialyltransferase 1	St6galnac1	ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	St6galnac1	ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1	Siat7A	sialyltransferase 7 ((alpha-N-acetylneuraminyl 2,3-beta-galactosyl-1,3)-N-acetyl galactosaminde alpha-2,6-sialyltransferase) A	Symbol and Name updated	1299863	APPROVED
2006-02-09	Siat7A	sialyltransferase 7 ((alpha-N-acetylneuraminyl 2,3-beta-galactosyl-1,3)-N-acetyl galactosaminde alpha-2,6-sialyltransferase) A			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)