Advanced Search (OLGA)

Gene: Slamf6 (SLAM family member 6) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Slamf6

Name:

SLAM family member 6

RGD ID:

1561848

Description:

Predicted to be involved in several processes, including T-helper 17 cell lineage commitment; natural killer cell activation; and positive regulation of cytokine production. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. Orthologous to human SLAMF6 (SLAM family member 6); INTERACTS WITH acetamide; alpha-Zearalanol; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC498287; RGD1561848; similar to lymphocyte antigen 108 isoform s

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLAMF6 (SLAM family member 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Slamf6 (SLAM family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slamf6 (SLAM family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLAMF6 (SLAM family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLAMF6 (SLAM family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slamf6 (SLAM family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLAMF6 (SLAM family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLAMF6 (SLAM family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slamf6 (SLAM family member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SLAMF6 (SLAM family member 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Slamf6 (SLAM family member 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	86,916,956 - 86,937,697 (+)	NCBI		GRCr8
mRatBN7.2	13	84,384,561 - 84,405,300 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	84,383,742 - 84,405,300 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	86,887,900 - 86,908,642 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	88,288,179 - 88,308,918 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	85,473,001 - 85,493,730 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	90,300,160 - 90,321,781 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	90,301,006 - 90,322,457 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	94,823,716 - 94,844,891 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	87,883,459 - 87,904,207 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	13	83,996,895 - 84,017,638 (+)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slamf6	Rat	autoimmune interstitial lung, joint, and kidney disease		ISO	RGD:1345807	8554872	ClinVar Annotator: match by term: Autoimmune interstitial lung disease-arthritis syndrome	ClinVar	PMID:28492532
Slamf6	Rat	gastrointestinal stromal tumor		ISO	RGD:1345807	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Slamf6	Rat	parathyroid carcinoma		ISO	RGD:1345807	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slamf6	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:1558045	6480464	1,2-Dimethylhydrazine results in increased expression of SLAMF6 mRNA	CTD	PMID:22206623
Slamf6	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1558045	6480464	Tetrachlorodibenzodioxin results in increased expression of SLAMF6 mRNA	CTD	PMID:26290441
Slamf6	Rat	2-butoxyethanol	decreases expression	ISO	RGD:1558045	6480464	n-butoxyethanol results in decreased expression of SLAMF6 mRNA	CTD	PMID:19812364
Slamf6	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of SLAMF6 mRNA	CTD	PMID:31881176
Slamf6	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1345807	6480464	Tretinoin results in increased expression of SLAMF6 mRNA	CTD	PMID:33167477
Slamf6	Rat	alpha-Zearalanol	increases expression	EXP		6480464	Zeranol results in increased expression of SLAMF6 mRNA	CTD	PMID:35163327
Slamf6	Rat	antirheumatic drug	decreases expression	ISO	RGD:1345807	6480464	Antirheumatic Agents results in decreased expression of SLAMF6 mRNA	CTD	PMID:24449571
Slamf6	Rat	aripiprazole	multiple interactions	ISO	RGD:1345807	6480464	[Aripiprazole co-treated with Ozone] results in increased expression of SLAMF6 mRNA	CTD	PMID:31476115
Slamf6	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1558045	6480464	Benzo(a)pyrene results in decreased expression of SLAMF6 mRNA	CTD	PMID:21569818
Slamf6	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1345807	6480464	Benzo(a)pyrene affects the methylation of SLAMF6 3' UTR	CTD	PMID:27901495
Slamf6	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1345807	6480464	Benzo(a)pyrene results in increased methylation of SLAMF6 promoter	CTD	PMID:27901495
Slamf6	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of SLAMF6 mRNA	CTD	PMID:25181051
Slamf6	Rat	bisphenol A	increases expression	ISO	RGD:1558045	6480464	bisphenol A results in increased expression of SLAMF6 mRNA	CTD	PMID:38701888
Slamf6	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of SLAMF6 gene	CTD	PMID:28505145
Slamf6	Rat	bromobenzene	increases expression	EXP		6480464	bromobenzene results in increased expression of SLAMF6 mRNA	CTD	PMID:32479839
Slamf6	Rat	buta-1,3-diene	decreases expression	ISO	RGD:1558045	6480464	1,3-butadiene results in decreased expression of SLAMF6 mRNA	CTD	PMID:29038090
Slamf6	Rat	carbon nanotube	increases expression	ISO	RGD:1558045	6480464	Nanotubes, Carbon results in increased expression of SLAMF6 mRNA	CTD	PMID:25554681
Slamf6	Rat	CGP 52608	multiple interactions	ISO	RGD:1345807	6480464	CGP 52608 promotes the reaction [RORA protein binds to SLAMF6 gene]	CTD	PMID:28238834
Slamf6	Rat	chloroprene	decreases expression	ISO	RGD:1558045	6480464	Chloroprene results in decreased expression of SLAMF6 mRNA	CTD	PMID:23125180
Slamf6	Rat	cisplatin	increases expression	ISO	RGD:1345807	6480464	Cisplatin results in increased expression of SLAMF6 mRNA	CTD	PMID:27594783
Slamf6	Rat	cisplatin	decreases expression	EXP		6480464	Cisplatin results in decreased expression of SLAMF6 mRNA	CTD	PMID:22023808
Slamf6	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1345807	6480464	di-n-butylphosphoric acid affects the expression of SLAMF6 mRNA	CTD	PMID:37042841
Slamf6	Rat	dimethylarsinic acid	multiple interactions	ISO	RGD:1558045	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Slamf6	Rat	genistein	increases expression	ISO	RGD:1558045	6480464	Genistein results in increased expression of SLAMF6 mRNA	CTD	PMID:32186404
Slamf6	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1345807	6480464	[S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of SLAMF6 mRNA	CTD	PMID:35811015
Slamf6	Rat	methylarsonic acid	multiple interactions	ISO	RGD:1558045	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Slamf6	Rat	nickel atom	decreases expression	ISO	RGD:1345807	6480464	Nickel results in decreased expression of SLAMF6 mRNA	CTD	PMID:23195993
Slamf6	Rat	nickel atom	increases expression	ISO	RGD:1345807	6480464	Nickel results in increased expression of SLAMF6 mRNA	CTD	PMID:25583101
Slamf6	Rat	nitrates	multiple interactions	ISO	RGD:1558045	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SLAMF6 more ...	CTD	PMID:35964746
Slamf6	Rat	ozone	multiple interactions	ISO	RGD:1345807	6480464	[Aripiprazole co-treated with Ozone] results in increased expression of SLAMF6 mRNA	CTD	PMID:31476115
Slamf6	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1345807	6480464	[S-(1,2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of SLAMF6 mRNA	CTD	PMID:35811015
Slamf6	Rat	silicon dioxide	increases expression	ISO	RGD:1558045	6480464	Silicon Dioxide results in increased expression of SLAMF6 mRNA	CTD	PMID:38811393
Slamf6	Rat	sodium arsenate	multiple interactions	ISO	RGD:1558045	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Slamf6	Rat	sodium arsenite	multiple interactions	ISO	RGD:1558045	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results more ...	CTD	PMID:34876320
Slamf6	Rat	sulforaphane	decreases expression	ISO	RGD:1345807	6480464	sulforaphane results in decreased expression of SLAMF6 mRNA	CTD	PMID:26833863
Slamf6	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of SLAMF6 mRNA	CTD	PMID:34492290
Slamf6	Rat	titanium dioxide	increases expression	ISO	RGD:1558045	6480464	titanium dioxide results in increased expression of SLAMF6 mRNA	CTD	PMID:23557971
Slamf6	Rat	titanium dioxide	affects expression	ISO	RGD:1558045	6480464	titanium dioxide affects the expression of SLAMF6 mRNA	CTD	PMID:17656681
Slamf6	Rat	trimellitic anhydride	increases expression	ISO	RGD:1558045	6480464	trimellitic anhydride results in increased expression of SLAMF6 mRNA	CTD	PMID:19042947
Slamf6	Rat	triphenyl phosphate	affects expression	ISO	RGD:1345807	6480464	triphenyl phosphate affects the expression of SLAMF6 mRNA	CTD	PMID:37042841

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slamf6	Rat	immune response	involved_in	IBA	MGI:109294\|MGI:1347250\|MGI:1923692\|PANTHER:PTN000249437\|UniProtKB:P06729\|UniProtKB:P19256\|UniProtKB:Q13291\|UniProtKB:Q96DU3\|UniProtKB:Q9BZW8\|UniProtKB:Q9HBG7	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Slamf6	Rat	natural killer cell differentiation	involved_in	ISO	RGD:1558045	1624291	PMID:18031695	RGD	PMID:18031695
Slamf6	Rat	natural killer cell proliferation	involved_in	ISO	RGD:1558045	1624291	PMID:18031695	RGD	PMID:18031695
Slamf6	Rat	positive regulation of interleukin-17 production	involved_in	ISO	RGD:1345807	1624291	PMID:22184727	RGD	PMID:22184727
Slamf6	Rat	positive regulation of natural killer cell mediated cytotoxicity	involved_in	ISO	RGD:1345807	1624291	PMID:16920955	RGD	PMID:16920955
Slamf6	Rat	positive regulation of type II interferon production	involved_in	ISO	RGD:1345807	1624291	PMID:16920955	RGD	PMID:16920955
Slamf6	Rat	T cell activation	involved_in	IBA	PANTHER:PTN008532932\|UniProtKB:Q96DU3\|UniProtKB:Q9HBG7	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Slamf6	Rat	T-helper 17 cell lineage commitment	involved_in	ISO	RGD:1345807	1624291	PMID:22184727	RGD	PMID:22184727

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slamf6	Rat	external side of plasma membrane	is_active_in	IBA	MGI:1922595\|PANTHER:PTN001382715	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Slamf6	Rat	membrane	located_in	IEA	InterPro:IPR015631	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Slamf6	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Slamf6	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Slamf6	Rat	plasma membrane	located_in	ISO	RGD:1345807	1624291	PMID:22184727	RGD	PMID:22184727

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Slamf6	Rat	protein binding	enables	ISO	RGD:1345807	1624291	UniProtKB:O14796\|UniProtKB:O60880\|UniProtKB:P55061\|UniProtKB:Q6PL45-2\|UniProtKB:Q6ZT21\|UniProtKB:Q8N5M9\|UniProtKB:Q8N6F1-2\|UniProtKB:Q9UI14 PMID:11489943, PMID:16920955, PMID:22912825, PMID:23346089, PMID:24688028, PMID:32296183	RGD	PMID:11489943\|PMID:16920955\|PMID:22912825\|PMID:23346089\|PMID:24688028\|PMID:32296183

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:16920955	PMID:18031695	PMID:20458337	PMID:22184727

Slamf6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	86,916,956 - 86,937,697 (+)	NCBI		GRCr8
mRatBN7.2	13	84,384,561 - 84,405,300 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	84,383,742 - 84,405,300 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	86,887,900 - 86,908,642 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	88,288,179 - 88,308,918 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	85,473,001 - 85,493,730 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	90,300,160 - 90,321,781 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	90,301,006 - 90,322,457 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	94,823,716 - 94,844,891 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	87,883,459 - 87,904,207 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	13	83,996,895 - 84,017,638 (+)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

SLAMF6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	160,485,036 - 160,523,255 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	160,485,030 - 160,523,262 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	160,454,826 - 160,493,045 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	158,721,444 - 158,759,666 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	157,267,892 - 157,306,115	NCBI
Celera	1	133,523,548 - 133,561,781 (-)	NCBI		Celera
Cytogenetic Map	1	q23.2-q23.3	NCBI
HuRef	1	131,811,030 - 131,849,265 (-)	NCBI		HuRef
CHM1_1	1	161,850,201 - 161,888,416 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	159,622,119 - 159,660,340 (-)	NCBI		T2T-CHM13v2.0

Slamf6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	171,745,002 - 171,776,525 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	171,745,082 - 171,780,737 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	171,917,458 - 171,948,958 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	171,917,515 - 171,953,170 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	173,847,668 - 173,873,999 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	173,754,212 - 173,780,543 (+)	NCBI		MGSCv36	mm8
Celera	1	174,769,000 - 174,795,180 (+)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	79.54	NCBI

Slamf6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955468	12,233,629 - 12,264,502 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLAMF6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	89,327,888 - 89,367,231 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	89,055,259 - 89,107,209 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	135,838,862 - 135,878,207 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	139,761,121 - 139,799,348 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	139,761,121 - 139,799,348 (-)	Ensembl	panpan1.1		panPan2

SLAMF6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	21,742,228 - 21,769,521 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	21,742,301 - 21,764,494 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	21,816,924 - 21,844,184 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	21,859,417 - 21,886,676 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	38	21,746,431 - 21,774,320 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	22,160,475 - 22,187,731 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	22,570,244 - 22,597,519 (+)	NCBI		UU_Cfam_GSD_1.0

Slamf6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	6,587,657 - 6,598,479 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936740	155,268 - 165,536 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLAMF6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	89,980,786 - 90,003,645 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	89,980,592 - 90,004,222 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	97,870,913 - 97,893,024 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLAMF6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	3,426,868 - 3,465,553 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	3,453,370 - 3,463,901 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	2,483,320 - 2,522,363 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slamf6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624794	754,530 - 796,732 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Slamf6
108 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	60
Count of miRNA genes:	56
Interacting mature miRNAs:	59
Transcripts:	ENSRNOT00000029315
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	66451204	106807694	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	74862117	85581182	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	59874408	85581182	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34663461	87525369	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	80753256	106807694	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	69060519	86800898	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	46197976	84753113	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	69060519	86800898	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	74023918	97213863	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	69060519	86800898	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	74862117	101339893	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	7	49	75	91	90	59	25	59	6	214	94	55	45	54	31


RefSeq Transcripts	NM_001191932	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006250301	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_595551	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000029315 ⟹ ENSRNOP00000035388

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	84,383,742 - 84,405,300 (+)	Ensembl
Rnor_6.0 Ensembl	13	90,301,006 - 90,322,457 (+)	Ensembl

RefSeq Acc Id:

NM_001191932 ⟹ NP_001178861

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	86,916,956 - 86,937,697 (+)	NCBI
mRatBN7.2	13	84,384,561 - 84,405,300 (+)	NCBI
Rnor_6.0	13	90,301,040 - 90,321,781 (+)	NCBI
Rnor_5.0	13	94,823,716 - 94,844,891 (+)	NCBI
Celera	13	83,996,895 - 84,017,638 (+)	NCBI

Sequence:

show sequence

ATGGCTGTCTCAAGGGCTCCAGCACACGACTCGGCTCGTCAGAGGATGGTCTGGCTGTTTCCACTTGTCTTCTGCCTCGGCACAGGGAGTGATGTTCCACAAAGCAGCTCAAACCCCCGACTCATGAA
TGGCATTCTAGGGGAGTCTATAGTTCTTCCTCTAGAGCTTCCAGCAGGAAAGATAGCCAGCGTCATCGTCTGGAGTCACAAAGAAGCATTGCAGGGCACTATAATGTTCATCATCCAACTAAAGGAGC
CCGAAAAGCCAAATATCATTAACGCTAATCGAGAGAAGGAGAAGAGACTGAATATCACCCAGTCCTACTCCTTGCAACTCAACAACCTTACAATGGCCGACACGGGGTCATACACTGCACAGATAACC
ACAGAAGACACTGAACCGACCATCTTCAGATATACTCTGAGGGTCTTTGAACGACTAAGTAACTTAGAAATTGCCAACCATACTCTCCTGCTAGAGAATGGCACCTGCCAGATGTACCTGGCCTGCAC
TGTGAAAAATTCAAATCAGACTGTCTCATTCGAGTGGCAAACCACGGGAAACATCTCTTTAAGGGAACCAAATGTCACTATCTCTTGGGACCCGAGGAATTCCAGCAACCAGACTTACATCTGCAGAG
CCGAGAATGCTGTCAGCAATTTGTCGGTCTCTGTCTCTACCCAGAGTCTCTGCAAAGATTTAACTAATCAACCCTGGACTAAAGCACAGCTTACAGCTATAATTTCAATACCCATGGTTGTAGTTATT
CCCGTCTTTCTGTACATGTGCATATATCTTTGGAAGAGAAGAAGAGGTTCTCTTCCTCTGACTCGCCAACATCCAGATTCCTCCCAGAGCTCAGATACTCCCGGCTCTCCTGGGAACACAGTGTATGC
ACAAGTCAGTCACCCGATGCAGGAAATGAAAATCCAAAATCCTATAAAAAATGACTCCATGACAATTTACTCCATAGTTAATCACTCCAGAGAGCCCGTTTCTCCTAGGCTGAATACTCTTAAGGACA
TCAAGTAAGTTGGTGAAAGACTTTAAAGAAAGCCAAGCAGAACACACCTCCTGATCCCTTGGAAGAGCACAGAAAAGAAGCCTGTTTTCCAACCGGCAATGGGATCCAGATACCCAGGGTGATCACTT
CAGACTTGATCCTCCATACACATGTCAGACGCTTCAGGAGTGGCAGGATCTGTAGAGACATAACCCCAAAATTGCTTTCCAATCAAATCCAGGACAAATCCTGCTTTGGATAACATACCCACGTGCTG
CTTCCTCTCTGATAACTAAACGATCAGACTTTCGATGGACAGATCATGATTCAGCAAGGAATTGTTTCTCCTCTAGAAGGCAGCAGGATGCGATTGGCTTGTAGAAAGAGCATGGTGTTTGGCTAAAT
GTGTAGCATCTGGCATTGGATGGGCCCACACACATGCCCTGACAAATCATTTACTTAGACAGGCCTCCTGGGGTAATTCCTATGTTCTTGGACTTTTAATCTCATAGCCAAGAATAAGAGGAGGATAG
CGATACACCGGTTCCATTGCTCACACCAGGAATCTAAGCCATACCTGACTACGGTTTAATCACCAAGCACTTGAGACTCTACCTCCAAAATATATTAAA

hide sequence


Protein RefSeqs	NP_001178861	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL94667	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035388
	ENSRNOP00000035388.4

RefSeq Acc Id:

NP_001178861 ⟸ NM_001191932

- UniProtKB:

D4A6B3 (UniProtKB/TrEMBL), A6JG11 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAVSRAPAHDSARQRMVWLFPLVFCLGTGSDVPQSSSNPRLMNGILGESIVLPLELPAGKIASVIVWSHKEALQGTIMFIIQLKEPEKPNIINANREKEKRLNITQSYSLQLNNLTMADTGSYTAQIT
TEDTEPTIFRYTLRVFERLSNLEIANHTLLLENGTCQMYLACTVKNSNQTVSFEWQTTGNISLREPNVTISWDPRNSSNQTYICRAENAVSNLSVSVSTQSLCKDLTNQPWTKAQLTAIISIPMVVVI
PVFLYMCIYLWKRRRGSLPLTRQHPDSSQSSDTPGSPGNTVYAQVSHPMQEMKIQNPIKNDSMTIYSIVNHSREPVSPRLNTLKDIK

hide sequence

Ensembl Acc Id:

ENSRNOP00000035388 ⟸ ENSRNOT00000029315

Protein Domains

Ig-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A6B3-F1-model_v2	AlphaFold	D4A6B3	1-343	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-17337	BioCyc
Ensembl Genes	ENSRNOG00000038286	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000029315	ENTREZGENE
	ENSRNOT00000029315.6	UniProtKB/TrEMBL
Gene3D-CATH	2.60.40.10	UniProtKB/TrEMBL
InterPro	CD2/SLAM_rcpt	UniProtKB/TrEMBL
	Ig-like	UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
KEGG Report	rno:498287	UniProtKB/TrEMBL
NCBI Gene	498287	ENTREZGENE
PANTHER	SIGNALING LYMPHOCYTIC ACTIVATION MOLECULE	UniProtKB/TrEMBL
	SLAM FAMILY MEMBER 6	UniProtKB/TrEMBL
PhenoGen	Slamf6	PhenoGen
PROSITE	IG_LIKE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000038286	RatGTEx
Superfamily-SCOP	SSF48726	UniProtKB/TrEMBL
UniProt	A6JG11	ENTREZGENE, UniProtKB/TrEMBL
	D4A6B3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-29	Slamf6	SLAM family member 6	RGD1561848_predicted	similar to lymphocyte antigen 108 isoform s (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1561848_predicted	similar to lymphocyte antigen 108 isoform s (predicted)	LOC498287	similar to lymphocyte antigen 108 isoform s	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC498287	similar to lymphocyte antigen 108 isoform s			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar