Symbol:
Efcab7
Name:
EF-hand calcium binding domain 7
RGD ID:
1561825
Description:
Predicted to enable calcium ion binding activity. Predicted to be involved in several processes, including positive regulation of protein localization; positive regulation of transcription by RNA polymerase II; and protein localization to motile cilium. Predicted to be located in cytoplasmic side of plasma membrane. Predicted to be part of plasma membrane protein complex. Predicted to be active in ciliary membrane. Orthologous to human EFCAB7 (EF-hand calcium binding domain 7); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; Cuprizon.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
EF-hand calcium-binding domain-containing protein 7; LOC362549; RGD1561825; similar to CDNA sequence BC020077
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 119,640,841 - 119,691,566 (+) NCBI GRCr8 mRatBN7.2 5 114,525,403 - 114,576,130 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 114,525,167 - 114,576,129 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 117,081,727 - 117,132,281 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 118,807,048 - 118,857,604 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 118,869,583 - 118,920,138 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 118,673,835 - 118,724,581 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 118,541,979 - 118,724,581 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 122,591,957 - 122,629,531 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 5 122,470,265 - 122,472,469 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 120,525,527 - 120,576,068 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 113,073,505 - 113,124,027 (+) NCBI Celera Cytogenetic Map 5 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Efcab7 Rat 1,2-dimethylhydrazine decreases expression ISO Efcab7 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of EFCAB7 mRNA CTD PMID:22206623 Efcab7 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:27291303 Efcab7 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Efcab7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of EFCAB7 mRNA CTD PMID:21570461 Efcab7 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of EFCAB7 mRNA CTD PMID:33387578 Efcab7 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Efcab7 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of EFCAB7 mRNA CTD PMID:20188158 Efcab7 Rat 4,4'-diaminodiphenylmethane decreases expression ISO Efcab7 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of EFCAB7 mRNA CTD PMID:18648102 Efcab7 Rat 4-hydroxyphenyl retinamide increases expression ISO Efcab7 (Mus musculus) 6480464 Fenretinide results in increased expression of EFCAB7 mRNA CTD PMID:28973697 Efcab7 Rat acrylamide increases expression ISO EFCAB7 (Homo sapiens) 6480464 Acrylamide results in increased expression of EFCAB7 mRNA CTD PMID:32763439 Efcab7 Rat aflatoxin B1 increases expression ISO Efcab7 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of EFCAB7 mRNA CTD PMID:19770486 Efcab7 Rat aflatoxin B1 decreases methylation ISO EFCAB7 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of EFCAB7 gene CTD PMID:27153756 Efcab7 Rat Aflatoxin B2 alpha decreases methylation ISO EFCAB7 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of EFCAB7 intron CTD PMID:30157460 Efcab7 Rat aflatoxin M1 decreases expression ISO EFCAB7 (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of EFCAB7 mRNA CTD PMID:30928695 Efcab7 Rat alcohol affects response to substance ISO Efcab7 (Mus musculus) 6480464 EFCAB7 protein affects the susceptibility to Alcohols CTD PMID:39366525 Efcab7 Rat arsane affects methylation ISO EFCAB7 (Homo sapiens) 6480464 Arsenic affects the methylation of EFCAB7 gene CTD PMID:25304211 Efcab7 Rat arsenic atom affects methylation ISO EFCAB7 (Homo sapiens) 6480464 Arsenic affects the methylation of EFCAB7 gene CTD PMID:25304211 Efcab7 Rat bis(2-ethylhexyl) phthalate increases expression ISO Efcab7 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of EFCAB7 mRNA CTD PMID:34319233 Efcab7 Rat bisphenol A increases expression ISO Efcab7 (Mus musculus) 6480464 bisphenol A results in increased expression of EFCAB7 mRNA CTD PMID:32156529 Efcab7 Rat calcitriol increases expression ISO EFCAB7 (Homo sapiens) 6480464 Calcitriol results in increased expression of EFCAB7 mRNA CTD PMID:16002434 Efcab7 Rat chlorpyrifos decreases expression ISO Efcab7 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of EFCAB7 mRNA CTD PMID:37019170 Efcab7 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of EFCAB7 mRNA CTD PMID:26577399 Efcab7 Rat cyclosporin A increases expression ISO EFCAB7 (Homo sapiens) 6480464 Cyclosporine results in increased expression of EFCAB7 mRNA CTD PMID:20106945 and PMID:25562108 Efcab7 Rat dicrotophos decreases expression ISO EFCAB7 (Homo sapiens) 6480464 dicrotophos results in decreased expression of EFCAB7 mRNA CTD PMID:28302478 Efcab7 Rat doxorubicin affects response to substance ISO EFCAB7 (Homo sapiens) 6480464 EFCAB7 protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Efcab7 Rat epoxiconazole increases expression ISO Efcab7 (Mus musculus) 6480464 epoxiconazole results in increased expression of EFCAB7 mRNA CTD PMID:35436446 Efcab7 Rat ethyl methanesulfonate increases expression ISO EFCAB7 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of EFCAB7 mRNA CTD PMID:23649840 Efcab7 Rat formaldehyde increases expression ISO EFCAB7 (Homo sapiens) 6480464 Formaldehyde results in increased expression of EFCAB7 mRNA CTD PMID:23649840 Efcab7 Rat FR900359 affects phosphorylation ISO EFCAB7 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of EFCAB7 protein CTD PMID:37730182 Efcab7 Rat hydrogen peroxide multiple interactions ISO Efcab7 (Mus musculus) 6480464 [Hydrogen Peroxide co-treated with N-(oxo-5 more ... CTD PMID:31494107 Efcab7 Rat lipopolysaccharide decreases expression ISO EFCAB7 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of EFCAB7 mRNA CTD PMID:35811015 Efcab7 Rat lipopolysaccharide multiple interactions ISO EFCAB7 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in decreased expression of EFCAB7 mRNA] CTD PMID:35811015 Efcab7 Rat methyl methanesulfonate increases expression ISO EFCAB7 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of EFCAB7 mRNA CTD PMID:23649840 Efcab7 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of EFCAB7 mRNA CTD PMID:25729387 Efcab7 Rat paclitaxel affects response to substance ISO EFCAB7 (Homo sapiens) 6480464 EFCAB7 protein affects the susceptibility to Paclitaxel CTD PMID:16217747 Efcab7 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of EFCAB7 mRNA CTD PMID:33387578 Efcab7 Rat quercetin decreases expression ISO EFCAB7 (Homo sapiens) 6480464 Quercetin results in decreased expression of EFCAB7 mRNA CTD PMID:21632981 Efcab7 Rat quinolin-8-ol decreases expression ISO EFCAB7 (Homo sapiens) 6480464 Oxyquinoline results in decreased expression of EFCAB7 mRNA CTD PMID:21632981 Efcab7 Rat resveratrol multiple interactions ISO EFCAB7 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of EFCAB7 mRNA CTD PMID:23557933 Efcab7 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO EFCAB7 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in decreased expression of EFCAB7 mRNA] CTD PMID:35811015 Efcab7 Rat succimer multiple interactions ISO Efcab7 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of EFCAB7 mRNA and [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of EFCAB7 mRNA CTD PMID:21641980 and PMID:26378955 Efcab7 Rat sunitinib decreases expression ISO EFCAB7 (Homo sapiens) 6480464 Sunitinib results in decreased expression of EFCAB7 mRNA CTD PMID:31533062 Efcab7 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of EFCAB7 mRNA CTD PMID:34492290 Efcab7 Rat titanium dioxide decreases methylation ISO Efcab7 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of EFCAB7 gene CTD PMID:35295148 Efcab7 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of EFCAB7 mRNA CTD PMID:25729387 Efcab7 Rat triphenyl phosphate affects expression ISO EFCAB7 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of EFCAB7 mRNA CTD PMID:37042841 Efcab7 Rat triptonide increases expression ISO Efcab7 (Mus musculus) 6480464 triptonide results in increased expression of EFCAB7 mRNA CTD PMID:33045310 Efcab7 Rat valproic acid decreases methylation ISO EFCAB7 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of EFCAB7 gene CTD PMID:29154799 Efcab7 Rat valproic acid increases expression ISO EFCAB7 (Homo sapiens) 6480464 Valproic Acid results in increased expression of EFCAB7 mRNA CTD PMID:24935251 and PMID:29154799 Efcab7 Rat vincaleukoblastine affects response to substance ISO EFCAB7 (Homo sapiens) 6480464 EFCAB7 protein affects the susceptibility to Vinblastine CTD PMID:16217747 Efcab7 Rat vinclozolin decreases methylation EXP 6480464 vinclozolin results in decreased methylation of EFCAB7 gene CTD PMID:31079544 and PMID:31682807 Efcab7 Rat vismodegib affects response to substance ISO Efcab7 (Mus musculus) 6480464 EFCAB7 protein affects the susceptibility to HhAntag691 CTD PMID:39366525 Efcab7 Rat zinc atom multiple interactions ISO EFCAB7 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of EFCAB7 mRNA CTD PMID:18593933 Efcab7 Rat zinc(0) multiple interactions ISO EFCAB7 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of EFCAB7 mRNA CTD PMID:18593933
1,2-dimethylhydrazine (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4-hydroxyphenyl retinamide (ISO) acrylamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aflatoxin M1 (ISO) alcohol (ISO) arsane (ISO) arsenic atom (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (ISO) calcitriol (ISO) chlorpyrifos (ISO) Cuprizon (EXP) cyclosporin A (ISO) dicrotophos (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethyl methanesulfonate (ISO) formaldehyde (ISO) FR900359 (ISO) hydrogen peroxide (ISO) lipopolysaccharide (ISO) methyl methanesulfonate (ISO) oxaliplatin (EXP) paclitaxel (ISO) paracetamol (EXP) quercetin (ISO) quinolin-8-ol (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) succimer (ISO) sunitinib (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vincaleukoblastine (ISO) vinclozolin (EXP) vismodegib (ISO) zinc atom (ISO) zinc(0) (ISO)
Efcab7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 119,640,841 - 119,691,566 (+) NCBI GRCr8 mRatBN7.2 5 114,525,403 - 114,576,130 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 114,525,167 - 114,576,129 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 117,081,727 - 117,132,281 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 118,807,048 - 118,857,604 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 118,869,583 - 118,920,138 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 118,673,835 - 118,724,581 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 118,541,979 - 118,724,581 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 122,591,957 - 122,629,531 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 5 122,470,265 - 122,472,469 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 120,525,527 - 120,576,068 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 5 113,073,505 - 113,124,027 (+) NCBI Celera Cytogenetic Map 5 q33 NCBI
EFCAB7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 63,523,525 - 63,585,370 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 63,523,372 - 63,572,693 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 63,989,196 - 64,038,364 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 63,761,856 - 63,810,952 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 62,278,938 - 62,328,273 (+) NCBI Celera Cytogenetic Map 1 p31.3 NCBI HuRef 1 62,097,101 - 62,146,337 (+) NCBI HuRef CHM1_1 1 64,104,820 - 64,154,155 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 63,399,112 - 63,465,319 (+) NCBI T2T-CHM13v2.0
Efcab7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 99,717,440 - 99,769,985 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 99,717,435 - 99,769,985 (+) Ensembl GRCm39 Ensembl GRCm38 4 99,829,445 - 99,912,788 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 99,829,198 - 99,912,788 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 99,550,648 - 99,585,390 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 99,375,977 - 99,410,717 (+) NCBI MGSCv36 mm8 Celera 4 98,205,751 - 98,257,285 (+) NCBI Celera Cytogenetic Map 4 C6 NCBI cM Map 4 45.71 NCBI
Efcab7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955423 26,474,568 - 26,509,196 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955423 26,473,310 - 26,510,704 (-) NCBI ChiLan1.0 ChiLan1.0
EFCAB7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 163,281,065 - 163,330,396 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 162,431,674 - 162,480,895 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 62,779,937 - 62,829,252 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 64,588,691 - 64,650,754 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 64,588,691 - 64,638,005 (+) Ensembl panpan1.1 panPan2
EFCAB7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 46,598,411 - 46,645,651 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 46,597,432 - 46,645,592 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 46,659,205 - 46,706,543 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 46,778,686 - 46,826,225 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 46,778,693 - 46,826,040 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 46,740,499 - 46,787,825 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 46,686,845 - 46,734,339 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 46,944,328 - 46,991,657 (-) NCBI UU_Cfam_GSD_1.0
Efcab7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 76,776,487 - 76,822,052 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936692 1,091,613 - 1,137,671 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936692 1,091,872 - 1,137,426 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EFCAB7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 148,851,183 - 148,994,952 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 148,939,050 - 148,997,790 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 137,259,099 - 137,317,498 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EFCAB7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 69,504,889 - 69,564,538 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 69,517,867 - 69,562,294 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 47,896,943 - 47,947,384 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Efcab7
.
Predicted Target Of
Count of predictions: 16 Count of miRNA genes: 14 Interacting mature miRNAs: 16 Transcripts: ENSRNOT00000013089 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 7794743 Bp373 Blood pressure QTL 373 0.0058 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 112175546 116047089 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1298070 Scl18 Serum cholesterol level QTL 18 3.7 blood LDL cholesterol amount (VT:0000181) calculated plasma low density lipoprotein cholesterol level (CMO:0001245) 5 79584860 124584860 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 1598859 Cm66 Cardiac mass QTL 66 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 79584860 124584860 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 1582212 Livw2 Liver weight QTL 2 3.5 0.0004 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 5 99016066 119085810 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 1598846 Bp293 Blood pressure QTL 293 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 79584860 124584860 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 1358909 Kidm25 Kidney mass QTL 25 1.87 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 90067849 128034027 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298086 Bp156 Blood pressure QTL 156 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 84132602 129132602 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358889 Bp261 Blood pressure QTL 261 2.86 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 90067849 128034027 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013089 ⟹ ENSRNOP00000013089
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 114,525,571 - 114,576,127 (+) Ensembl Rnor_6.0 Ensembl 5 118,541,979 - 118,724,581 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103769 ⟹ ENSRNOP00000085104
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 114,527,607 - 114,576,129 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106347 ⟹ ENSRNOP00000076772
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 114,525,167 - 114,576,129 (+) Ensembl
RefSeq Acc Id:
NM_001191866 ⟹ NP_001178795
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 119,641,025 - 119,691,565 (+) NCBI mRatBN7.2 5 114,525,589 - 114,576,129 (+) NCBI Rnor_6.0 5 118,674,041 - 118,724,581 (+) NCBI Rnor_5.0 5 122,470,265 - 122,472,469 (+) NCBI Rnor_5.0 5 122,591,957 - 122,629,531 (+) NCBI Celera 5 113,073,505 - 113,124,027 (+) NCBI
Sequence:
AAAAAGGCGGAGGTCTGTCGGGTTGCGCTGAGAGGTTCGCGGAACTACTAAAGAAAATTGGCTGCTCTTCTTGGTTTGTGAGCTGAAATTAGAATGGCCAGCAATCCTGGAAGTGATGCAGCTTTGGA
hide sequence
RefSeq Acc Id:
XM_008763885 ⟹ XP_008762107
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 119,640,841 - 119,691,566 (+) NCBI mRatBN7.2 5 114,525,403 - 114,576,130 (+) NCBI Rnor_6.0 5 118,673,835 - 118,724,576 (+) NCBI
Sequence:
AAGGCCAGAACCCATCTAGCCCCAGCCGCGTGCAGCACACGACCCTCTCTCACTATCCTGGACATACCAGCCTCCCAAAGGATAAGCTACAATGCCATGACTGTTTTCTGTCGGTCAATAGTCCACAG
hide sequence
RefSeq Acc Id:
XM_008763886 ⟹ XP_008762108
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 119,640,878 - 119,691,566 (+) NCBI mRatBN7.2 5 114,525,447 - 114,576,130 (+) NCBI Rnor_6.0 5 118,673,953 - 118,724,576 (+) NCBI
Sequence:
TAGTCCACAGATCTCTAGTCGGAGCGTTTGGAAGGTGCTCTGCCTCTTACTTCCGGTGGCGGGG
hide sequence
RefSeq Acc Id:
XM_039110289 ⟹ XP_038966217
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 119,640,997 - 119,691,566 (+) NCBI mRatBN7.2 5 114,525,561 - 114,576,130 (+) NCBI
RefSeq Acc Id:
XM_039110290 ⟹ XP_038966218
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 119,643,042 - 119,691,566 (+) NCBI mRatBN7.2 5 114,525,662 - 114,576,130 (+) NCBI
RefSeq Acc Id:
XM_039110291 ⟹ XP_038966219
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 119,640,841 - 119,672,509 (+) NCBI mRatBN7.2 5 114,525,403 - 114,557,141 (+) NCBI
RefSeq Acc Id:
XR_010066420
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 119,640,841 - 119,672,509 (+) NCBI
RefSeq Acc Id:
NP_001178795 ⟸ NM_001191866
- UniProtKB:
D3ZZK0 (UniProtKB/TrEMBL), A0A8I6A396 (UniProtKB/TrEMBL)
- Sequence:
MASNPGSDAALDTQKSVLSGSPRTKKFPLTEQEVFYMNCRAAYLTIFKSSLENIMSKDQLYLALQHAGRNPSQKTINKYWTPQTAKLNFDDFCIILSKEKPTSKADLLKSFKQLDVNDDGSILHSDLH
hide sequence
RefSeq Acc Id:
XP_008762107 ⟸ XM_008763885
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5Y0R4 (UniProtKB/TrEMBL), A0A8I6A396 (UniProtKB/TrEMBL)
- Sequence:
MTVFCRSIVHRSLVGAFGRMASNPGSDAALDTQKSVLSGSPRTKKFPLTEQEVFYMNCRAAYLTIFKSSLENIMSKDQLYLALQHAGRNPSQKTINKYWTPQTAKLNFDDFCIILSKEKPTSKADLLK
hide sequence
RefSeq Acc Id:
XP_008762108 ⟸ XM_008763886
- Peptide Label:
isoform X2
- UniProtKB:
D3ZZK0 (UniProtKB/TrEMBL), A0A8I6A396 (UniProtKB/TrEMBL)
- Sequence:
MASNPGSDAALDTQKSVLSGSPRTKKFPLTEQEVFYMNCRAAYLTIFKSSLENIMSKDQLYLAL
hide sequence
Ensembl Acc Id:
ENSRNOP00000013089 ⟸ ENSRNOT00000013089
RefSeq Acc Id:
XP_038966219 ⟸ XM_039110291
- Peptide Label:
isoform X4
- UniProtKB:
A6JRM4 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966217 ⟸ XM_039110289
- Peptide Label:
isoform X2
- UniProtKB:
D3ZZK0 (UniProtKB/TrEMBL), A0A8I6A396 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966218 ⟸ XM_039110290
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6A396 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000085104 ⟸ ENSRNOT00000103769
Ensembl Acc Id:
ENSRNOP00000076772 ⟸ ENSRNOT00000106347
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-29
Efcab7
EF-hand calcium binding domain 7
RGD1561825_predicted
similar to CDNA sequence BC020077 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1561825_predicted
similar to CDNA sequence BC020077 (predicted)
LOC362549
similar to CDNA sequence BC020077
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC362549
similar to CDNA sequence BC020077
Symbol and Name status set to provisional
70820 PROVISIONAL
