Advanced Search (OLGA)

Gene: Dnajc25 (DnaJ heat shock protein family (Hsp40) member C25) Rattus norvegicus

Analyze

Symbol:

Dnajc25

Name:

DnaJ heat shock protein family (Hsp40) member C25

RGD ID:

1561488

Description:

Predicted to be involved in protein folding. Predicted to be located in membrane. Predicted to be active in endoplasmic reticulum membrane. Orthologous to several human genes including DNAJC25 (DnaJ heat shock protein family (Hsp40) member C25); INTERACTS WITH (+)-schisandrin B; bisphenol A; endosulfan.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DnaJ (Hsp40) homolog, subfamily C, member 25; dnaJ homolog subfamily C member 25; hypothetical protein LOC362526; LOC362526; MGC109221

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	78,620,608 - 78,642,921 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	78,620,581 - 78,642,920 (+)	Ensembl				GRCr8
mRatBN7.2	5	73,825,565 - 73,847,878 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	73,825,565 - 73,845,433 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	75,726,822 - 75,746,699 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	77,548,442 - 77,568,319 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	77,520,592 - 77,540,471 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	5	78,682,922 - 78,702,788 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	5	80,349,553 - 80,369,418 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	5	79,571,394 - 79,591,260 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	5	73,442,316 - 73,462,186 (+)	NCBI		F344_StmMcwi
Rnor_6.0	5	76,150,840 - 76,171,424 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	76,150,840 - 76,171,423 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	80,295,287 - 80,315,201 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	77,052,810 - 77,072,780 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	72,647,848 - 72,667,717 (+)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

2-palmitoylglycerol (ISO)

aflatoxin B1 (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

endosulfan (EXP)

glycidyl methacrylate (ISO)

GSK-J4 (ISO)

paracetamol (EXP)

pirinixic acid (ISO)

sodium arsenite (ISO)

tetrachloromethane (EXP)

thiram (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

tunicamycin (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein folding (IBA,IEA)

Cellular Component

endoplasmic reticulum membrane (IBA)

membrane (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Genomics

Comparative Map Data

Dnajc25
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	78,620,608 - 78,642,921 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	78,620,581 - 78,642,920 (+)	Ensembl				GRCr8
mRatBN7.2	5	73,825,565 - 73,847,878 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	73,825,565 - 73,845,433 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	75,726,822 - 75,746,699 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	77,548,442 - 77,568,319 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	77,520,592 - 77,540,471 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	5	78,682,922 - 78,702,788 (+)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	5	80,349,553 - 80,369,418 (+)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	5	79,571,394 - 79,591,260 (+)	NCBI		Lyon_Hypertensive
F344_StmMcwi	5	73,442,316 - 73,462,186 (+)	NCBI		F344_StmMcwi
Rnor_6.0	5	76,150,840 - 76,171,424 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	76,150,840 - 76,171,423 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	80,295,287 - 80,315,201 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	77,052,810 - 77,072,780 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	72,647,848 - 72,667,717 (+)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

DNAJC25
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	111,631,334 - 111,654,345 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	111,631,334 - 111,654,351 (+)	Ensembl			hg38	GRCh38
GRCh37	9	114,393,614 - 114,416,625 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	113,433,453 - 113,456,452 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	9	84,892,702 - 84,915,694 (+)	NCBI		Celera
Cytogenetic Map	9	q31.3	NCBI
HuRef	9	83,992,211 - 84,015,151 (+)	NCBI		HuRef
CHM1_1	9	114,540,098 - 114,563,025 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	123,802,699 - 123,825,706 (+)	NCBI		T2T-CHM13v2.0

Dnajc25
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	58,995,215 - 59,025,573 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	58,995,062 - 59,025,573 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	58,994,799 - 59,025,573 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	58,995,062 - 59,025,573 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	59,016,065 - 59,036,270 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	59,097,553 - 59,117,046 (+)	NCBI		MGSCv36	mm8
Celera	4	58,916,366 - 58,936,424 (+)	NCBI		Celera
Cytogenetic Map	4	B3	NCBI
cM Map	4	32.36	NCBI

DNAJC25
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	27,776,610 - 27,796,075 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	27,774,026 - 27,798,407 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	82,764,623 - 82,784,058 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	110,926,351 - 110,946,346 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	110,926,351 - 110,946,346 (+)	Ensembl			panPan2	panpan1.1

DNAJC25
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	66,234,583 - 66,261,153 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	66,234,583 - 66,261,153 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	64,645,331 - 64,671,899 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	67,367,623 - 67,394,819 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	67,367,623 - 67,394,819 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	65,884,617 - 65,911,582 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	65,908,335 - 65,935,106 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	66,598,328 - 66,625,094 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Dnajc25
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	181,561,489 - 181,579,335 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936559	1,686,355 - 1,705,110 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936559	1,687,214 - 1,705,075 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DNAJC25
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	252,426,444 - 252,447,095 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	252,426,357 - 252,445,622 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	283,222,179 - 283,226,635 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DNAJC25
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	27,853,738 - 27,874,545 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	27,854,871 - 27,874,432 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666035	14,907,907 - 14,928,675 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dnajc25
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	23,346,352 - 23,374,068 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624760	23,348,575 - 23,374,093 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Dnajc25
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	92,417,900 - 92,437,460 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Dnajc25
87 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	42
Count of miRNA genes:	41
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000020702
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	38011670	83011670	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	52665372	94894052	Rat
1357396	Bw44	Body weight QTL 44	4.19		body mass (VT:0001259)	body weight (CMO:0000012)	5	73779642	118779642	Rat
6907115	Mcs29	Mammary carcinoma susceptibility QTL 29			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	38004331	83004331	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
61380	Edpm5	Estrogen-dependent pituitary mass QTL 5	4.5	0.92	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	5	73779642	103472210	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	23671493	79046465	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	65089051	103648916	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
2302381	Bw84	Body weight QTL 84	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	73779642	118779642	Rat
1357402	Bw46	Body weight QTL 46	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	73779642	118779642	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	38011670	83011670	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	38011670	83011670	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
1331782	Rf36	Renal function QTL 36	3.296		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	39019942	102105896	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	39985948	84985948	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	6922282	81330203	Rat
7394708	Emca11	Estrogen-induced mammary cancer QTL 11			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	73176602	118176602	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	39526924	84526924	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	48523123	91770353	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	69474415	114474415	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	91770353	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	60511627	105511627	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	64589016	109589016	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	69835120	114835120	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	87027358	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	70969494	136328156	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	64589016	93503770	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	56546393	101546393	Rat
2312671	Scl64	Serum cholesterol level QTL 64		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	73779642	118779642	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	64589016	91762830	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110251	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091296	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020702 ⟹ ENSRNOP00000020702

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	78,620,581 - 78,642,915 (+)	Ensembl
mRatBN7.2 Ensembl	5	73,825,565 - 73,845,433 (+)	Ensembl
Rnor_6.0 Ensembl	5	76,150,840 - 76,171,423 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000155573 ⟹ ENSRNOP00000112589

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	78,620,586 - 78,642,920 (+)	Ensembl

RefSeq Acc Id:

NM_001025021 ⟹ NP_001020192

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	78,620,608 - 78,640,477 (+)	NCBI
mRatBN7.2	5	73,825,565 - 73,845,434 (+)	NCBI
Dahl_SR_JrHsd	5	78,682,922 - 78,702,788 (+)	NCBI
Lyon_Normotensive	5	80,349,553 - 80,369,418 (+)	NCBI
Lyon_Hypertensive	5	79,571,394 - 79,591,260 (+)	NCBI
F344_StmMcwi	5	73,442,316 - 73,462,186 (+)	NCBI
Rnor_6.0	5	76,150,840 - 76,171,424 (+)	NCBI
Rnor_5.0	5	80,295,287 - 80,315,201 (+)	NCBI
RGSC_v3.4	5	77,052,810 - 77,072,780 (+)	RGD
Celera	5	72,647,848 - 72,667,717 (+)	RGD

Sequence:

show sequence

CCGGCGCTGAGGAGAGCTGCAGTGGCCGCTGTGCTGGCAGAGCGGCGACCGAGGTGGGATGGCG
GCGCGGCTCGCTTGGCGCAGGGGACCCGGGGCTGCGGGCCAGCGCCCATGGCTGCTGCTGGCAC
CGCTGCTGCTGGTCCCGCTGCTGGTGCGGCCCGCTGAGGCCCTGGTGGAAGGGCTGTACTGCGG
CACGCGCGACTGCTACGAGGTGCTGGGCGTGAGCCGCTCGGCCAGCAAGGCGGAGATCGCGCGG
GCCTACCGGCAGCTGGCCCGGCGCTACCACCCGGATCGCTACCGGCCCGAGCCCGGAGACGGCC
CCGGAGGCGCGCCGCCGAGCGCTGAGGCTTTCCTGCTAGTGGCGACCGCCTACGAGACGCTCAA
GGATGAAGAAACACGGAAGGACTATGACTACATGCTGGACCACCCAGAAGAGTACTACAGCCAT
TACTACCACTACTACAGCAGGCGCCTAGCCCCTAAAGTGGACGTCAGGGTGGTGATTCTGGTCA
GCGTGTGTGCCATTTCAGTGTTTCAGTATTTCAGCTGGTGGAACAGCTACAACAAATCAATCAG
CTACTTAGCCACAGTGCCCAAGTACCGCATCCAGGCCACAGAGATCGCCAAGGAGCAGGGACTG
CTCAAAAAAGCCAAAGAAAAGGGGAAAAACAAGAAGTCCAAAGAAGAAATCCGTGATGAGGAGG
AGAACATCATAAAGAATATTATAAAAAGTAAGATAGACATAAAGGGGGGCTACCAGAAACCTCA
AGTTCGGGACCTCCTCTTGTTCCAAGTCCTCCTCGCCCCTGTCCACCTGTGCTCCTACATAGCC
TGGTATTGCCGGTGGGTCTATAACTTTAACATCAAAGGCAAGGAGTACGGGGAGGAGGAGAGGC
TTTACATCATACGCAAGTCCATGAAGATGTCCCAGTCTCAGTTCGACAGCCTGGAGGACCATCA
GAAAGAAATGTTTCTCAAACGGGAGCTTTGGATAAAAGAGAATTACGAGGTCTACAAGCAGGAA
CAGGAGGAAGAGTTAAAGAAAAAGCTGGCCAACGACCCTCGGTGGAAGCGATACCGCAGGTGGA
TGAAGAACGAGGGGCCTGGGCGGTTGACCTTTGTGGACGACTGAGGGAGATGGGGCACTGCTAT
GCCGGACTCTGGATGTGACGTCACTTGCATAGTGGTTACTTGGAAATGTGCCTGCTGCTCTCAG
CGGTGACTAACGCTCACACAAGTACATGATTAAACAGAATAATGTAGACATTTCAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039110251 ⟹ XP_038966179

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	78,630,840 - 78,642,921 (+)	NCBI
mRatBN7.2	5	73,825,759 - 73,847,878 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020192	(Get FASTA)	NCBI Sequence Viewer
	XP_038966179	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91296	(Get FASTA)	NCBI Sequence Viewer
	EDL91646	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020702
	ENSRNOP00000112589
GenBank Protein	Q5BJW9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001020192 ⟸ NM_001025021
- Peptide Label:	precursor
- UniProtKB:	Q5BJW9 (UniProtKB/Swiss-Prot), F1LQT0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAARLAWRRGPGAAGQRPWLLLAPLLLVPLLVRPAEALVEGLYCGTRDCYEVLGVSRSASKAEI ARAYRQLARRYHPDRYRPEPGDGPGGAPPSAEAFLLVATAYETLKDEETRKDYDYMLDHPEEYY SHYYHYYSRRLAPKVDVRVVILVSVCAISVFQYFSWWNSYNKSISYLATVPKYRIQATEIAKEQ GLLKKAKEKGKNKKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQVRDLLLFQVLLAPVHLCSY IAWYCRWVYNFNIKGKEYGEEERLYIIRKSMKMSQSQFDSLEDHQKEMFLKRELWIKENYEVYK QEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTFVDD hide sequence

Ensembl Acc Id:

ENSRNOP00000020702 ⟸ ENSRNOT00000020702

RefSeq Acc Id:	XP_038966179 ⟸ XM_039110251
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000112589 ⟸ ENSRNOT00000155573

Protein Domains

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BJW9-F1-model_v2	AlphaFold	Q5BJW9	1-357	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693767

Promoter ID:

EPDNEW_R4292

Type:

initiation region

Name:

Dnajc25_1

Description:

DnaJ heat shock protein family member C25

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	76,150,836 - 76,150,896	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561488	AgrOrtholog
BioCyc Gene	G2FUF-41163	BioCyc
Ensembl Genes	ENSRNOG00000015340	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000020702	ENTREZGENE
	ENSRNOT00000155573	ENTREZGENE
Gene3D-CATH	1.10.287.110	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7308787	IMAGE-MGC_LOAD
InterPro	DnaJ_domain	UniProtKB/Swiss-Prot
	DNAJC25-like	UniProtKB/Swiss-Prot
	J_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:362526	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109221	IMAGE-MGC_LOAD
NCBI Gene	362526	ENTREZGENE
PANTHER	DNAJ HOMOLOG SUBFAMILY C MEMBER 25	UniProtKB/Swiss-Prot
	PTHR44176	UniProtKB/Swiss-Prot
Pfam	DnaJ	UniProtKB/Swiss-Prot
PhenoGen	Dnajc25	PhenoGen
PRINTS	JDOMAIN	UniProtKB/Swiss-Prot
PROSITE	DNAJ_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000015340	RatGTEx
SMART	DnaJ	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46565	UniProtKB/Swiss-Prot
UniProt	A0ABK0M346_RAT	UniProtKB/TrEMBL
	DJC25_RAT	UniProtKB/Swiss-Prot
	F1LQT0	ENTREZGENE, UniProtKB/TrEMBL
	Q5BJW9	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-11-25	Dnajc25	DnaJ heat shock protein family (Hsp40) member C25	Dnajc25	DnaJ (Hsp40) homolog, subfamily C, member 25	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-03-16	Dnajc25	DnaJ (Hsp40) homolog, subfamily C, member 25	LOC362526	hypothetical protein LOC362526	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-02-09	LOC362526	hypothetical protein LOC362526			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message