Advanced Search (OLGA)

Gene: Slc38a8 (solute carrier family 38, member 8) Rattus norvegicus

Analyze

Symbol:

Slc38a8

Name:

solute carrier family 38, member 8

RGD ID:

1560237

Description:

Predicted to enable L-amino acid transmembrane transporter activity. Predicted to be involved in amino acid transmembrane transport. Predicted to act upstream of or within several processes, including nervous system development; retinal pigment epithelium development; and visual perception. Predicted to be located in axon. Predicted to be active in membrane. Human ortholog(s) of this gene implicated in foveal hypoplasia 2. Orthologous to human SLC38A8 (solute carrier family 38 member 8); INTERACTS WITH bisphenol A; copper atom; copper(0).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC502208; putative sodium-coupled neutral amino acid transporter 8; RGD1560237; similar to Gene model 587; solute carrier family 38 member 8

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLC38A8 (solute carrier family 38 member 8)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Slc38a8 (solute carrier family 38, member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Slc38a8 (solute carrier family 38 member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLC38A8 (solute carrier family 38 member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLC38A8 (solute carrier family 38 member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Slc38a8 (solute carrier family 38 member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLC38A8 (solute carrier family 38 member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLC38A8 (solute carrier family 38 member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Slc38a8 (solute carrier family 38 member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Slc38a8 (solute carrier family 38 member 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Slc38a8 (solute carrier family 38, member 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	SLC38A8 (solute carrier family 38 member 8)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc38a8b (solute carrier family 38 member 8b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc38a8a (solute carrier family 38 member 8a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	AVT7	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector)
Saccharomyces cerevisiae (baker's yeast):	AVT7	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	AVT5	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector)
Saccharomyces cerevisiae (baker's yeast):	AVT6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	AVT6	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	slc38a8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	64,432,524 - 64,468,852 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	64,437,013 - 64,463,960 (-)	Ensembl				GRCr8
mRatBN7.2	19	47,522,781 - 47,561,443 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	47,525,301 - 47,554,726 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	54,329,461 - 54,349,105 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	55,010,294 - 55,029,882 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	57,223,651 - 57,243,307 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	19	58,240,299 - 58,261,573 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	19	56,363,904 - 56,385,178 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	19	58,238,025 - 58,259,354 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	19	55,970,909 - 55,992,183 (-)	NCBI		F344_StmMcwi
Rnor_6.0	19	52,110,517 - 52,142,500 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	52,119,992 - 52,139,633 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	62,868,486 - 62,889,215 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	49,724,607 - 49,744,249 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	46,794,134 - 46,813,788 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Foveal Hypoplasia (ISO)

foveal hypoplasia 2 (ISO,ISS)

genetic disease (ISO)

Leber congenital amaurosis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (ISO)

2-palmitoylglycerol (ISO)

Aflatoxin B2 alpha (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP)

Butylbenzyl phthalate (ISO)

chlorpyrifos (ISO)

copper atom (EXP)

copper(0) (EXP)

dimethylarsinic acid (ISO)

doxorubicin (ISO)

folic acid (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methapyrilene (ISO)

methylarsonic acid (ISO)

resveratrol (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

titanium dioxide (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

amino acid transmembrane transport (IBA)

aspartate metabolic process (ISO)

L-alpha-amino acid transmembrane transport (IEA)

monoatomic cation transmembrane transport (IEA)

neuron projection development (ISO)

neutral amino acid transport (IEA)

optic nerve development (ISO)

response to virus (ISO)

retina development in camera-type eye (ISO)

retinal pigment epithelium development (ISO)

transmembrane transport (IEA)

viral genome replication (ISO)

visual perception (ISO)

Cellular Component

membrane (IBA,IEA)

Molecular Function

L-amino acid transmembrane transporter activity (IBA)

monoatomic cation transmembrane transporter activity (IEA)

neutral L-amino acid transmembrane transporter activity (IEA)

secondary active transmembrane transporter activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Slc38a8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	64,432,524 - 64,468,852 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	64,437,013 - 64,463,960 (-)	Ensembl				GRCr8
mRatBN7.2	19	47,522,781 - 47,561,443 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	47,525,301 - 47,554,726 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	54,329,461 - 54,349,105 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	55,010,294 - 55,029,882 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	57,223,651 - 57,243,307 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	19	58,240,299 - 58,261,573 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	19	56,363,904 - 56,385,178 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	19	58,238,025 - 58,259,354 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	19	55,970,909 - 55,992,183 (-)	NCBI		F344_StmMcwi
Rnor_6.0	19	52,110,517 - 52,142,500 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	52,119,992 - 52,139,633 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	62,868,486 - 62,889,215 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	49,724,607 - 49,744,249 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	46,794,134 - 46,813,788 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

SLC38A8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	84,009,667 - 84,043,372 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	84,009,667 - 84,043,143 (-)	Ensembl			hg38	GRCh38
GRCh37	16	84,043,272 - 84,076,400 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	82,600,890 - 82,633,263 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	16	68,345,794 - 68,378,119 (-)	NCBI		Celera
Cytogenetic Map	16	q23.3	NCBI
HuRef	16	69,797,338 - 69,829,598 (-)	NCBI		HuRef
CHM1_1	16	85,454,749 - 85,487,120 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	90,075,718 - 90,109,442 (-)	NCBI		T2T-CHM13v2.0

Slc38a8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	120,206,313 - 120,228,503 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	120,206,341 - 120,228,437 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	119,479,574 - 119,501,698 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	119,479,602 - 119,501,698 (-)	Ensembl			mm10	GRCm38
MGSCv37	8	122,003,502 - 122,025,598 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	122,365,579 - 122,387,675 (-)	NCBI		MGSCv36	mm8
Celera	8	123,696,930 - 123,719,116 (-)	NCBI		Celera
Cytogenetic Map	8	E1	NCBI
cM Map	8	67.8	NCBI

Slc38a8
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955564	230,610 - 253,523 (+)	Ensembl
ChiLan1.0	NW_004955564	233,796 - 252,565 (+)	NCBI	ChiLan1.0	ChiLan1.0

SLC38A8
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	93,757,729 - 93,791,473 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	99,674,942 - 99,708,625 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	64,676,787 - 64,709,083 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	84,020,379 - 84,053,359 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	84,020,458 - 84,053,458 (-)	Ensembl			panPan2	panpan1.1

SLC38A8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	68,289,864 - 68,308,381 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	68,289,485 - 68,308,340 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	68,301,246 - 68,322,415 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	68,585,185 - 68,606,544 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	68,587,834 - 68,606,543 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	68,532,930 - 68,554,254 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	68,369,496 - 68,390,660 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	68,785,243 - 68,806,413 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Slc38a8
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	27,995,807 - 28,028,525 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936641	3,757,130 - 3,774,098 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936641	3,757,107 - 3,778,939 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC38A8
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	4,564,533 - 4,594,520 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	4,563,967 - 4,593,667 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

SLC38A8
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	69,421,171 - 69,455,073 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666047	6,305,409 - 6,353,493 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc38a8
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	3,529,507 - 3,547,445 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624746	3,528,713 - 3,554,017 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Slc38a8
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	39,127,569 - 39,147,603 (-)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	63
Count of miRNA genes:	56
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000038580
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	46226778	74246245	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
2313395	Anxrr26	Anxiety related response QTL 26			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	19	44385134	74246245	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
5135224	Leukc1	Leukocyte quantity QTL 1			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	19	61249161	74246245	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	41722546	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	59	161	84	83	52	86	52	6	333	178	11	140	79	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001192009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006255722	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063278261	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_597269	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000038580 ⟹ ENSRNOP00000038726

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	64,437,013 - 64,463,960 (-)	Ensembl
mRatBN7.2 Ensembl	19	47,525,301 - 47,554,726 (-)	Ensembl
Rnor_6.0 Ensembl	19	52,119,992 - 52,139,633 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000171668 ⟹ ENSRNOP00000102529

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	64,442,631 - 64,463,960 (-)	Ensembl

RefSeq Acc Id:

NM_001192009 ⟹ NP_001178938

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	64,442,631 - 64,463,960 (-)	NCBI
mRatBN7.2	19	47,533,985 - 47,555,316 (-)	NCBI
Dahl_SR_JrHsd	19	58,240,299 - 58,261,573 (-)	NCBI
Lyon_Normotensive	19	56,363,904 - 56,385,178 (-)	NCBI
Lyon_Hypertensive	19	58,238,025 - 58,259,354 (-)	NCBI
F344_StmMcwi	19	55,970,909 - 55,992,183 (-)	NCBI
Rnor_6.0	19	52,119,992 - 52,139,633 (-)	NCBI
Rnor_5.0	19	62,868,486 - 62,889,215 (-)	NCBI
Celera	19	46,794,134 - 46,813,788 (-)	NCBI

Sequence:

show sequence

ATGGAAGGGCAGACCAGAGGGAGCAGAGGCCTTCCGGAGAAGCCCCTCCCTGCTACCACCCATC
CCCCTCTGTCCTCACTGGGCGCCGTGTTCATCCTCCTGAAGTCCGCACTGGGAGCTGGCCTGCT
CAACTTCCCCTGGGCCTTCTACAAGGCAGGAGGCCTGGTGCCCACCTTCCTGGTGGCACTGGTA
TCCTTGGTCTTCCTGATCAGCGGTCTGGTCATCCTGGGCTATGCAGCATCTGTCAGTGGCCAGA
CCACCTACCAGGGTGTGGTCCGTGAGTTATGTGGCCCCGCCATGGGGAAGCTGTGTGAGGCTTG
CTTCCTGACCAACCTGCTCATGATCTCCGTAGCCTTCCTCAGAGTGATCGGGGACCAACTGGAA
AAGTTGTGTGACTCCCTCCTGCCTGACGCCCCACAGCCCTGGTACGCAGCCCAAAGCTTCACCC
TGCCCCTGATCTCCGTGCTGGTCATCTTCCCCCTGTCAGCACTTCGGGACATCGCCCTCCAGGA
GTACACCAGCATCCTAGGTACTCTGGCTGCCTGCTACCTTGCTCTGGTCATCACTGTGCAGTAC
TACTTATGGCCCCAGGGCCTTATACGACAGCCCGGTCCTTTGCTGAGCCCATCTCCCTGGACCT
CTGTGTTTAGTGTCTTCCCTACCATCTGCTTTGGATTCCAGTGTCATGAGGCCGCGGTCTCCAT
CTACTGCAGCATGCAGAACCAGAGCCTCCCCCACTGGACCTTGGTTTCTGTGTTGTCCTTAATG
GCCTGCTGCCTTGTCTACACGCTGACAGGGGTTTATGGCTTCCTGACCTTCGGGACGGAAGTTT
CTGCTGATATCTTAATGTCCTACCCAGGCAATGACACAGCCATCATTGTAGCTCGGGTTCTCTT
TGCTGTCTCCATTGTGACCGTCTACCCCATCGTGCTGTTCCTGGGGAGGTCTGTGATGCAGGAC
TTTTGGAAAAAGAGCTACTGGGCCACACAGGGGTCCCCAGTGCTGGCTGACCCCTCAGGGCCTT
GGGTTCGGCTGCCACTGACCTTCCTGTGGGTGGCAGTGACGCTCGCCATGGCTCTGTTCCTACC
GGACCTCAGCGAGATCATTGGCGTCATCGGTGGCCTCAGCGCCTTCTTCATCTTCATCTTCCCA
GGTTTGTGCCTCATCTCTGCTGTGGACACGGAGCCCATAGGACCAAGAGTCAAGTGCTGCCTGG
AGGCCTGGGGCACCCTCTCTGTGCTGCTGGGCACCTTCGTCTTTGGGCAGAGCACAGCTGGGGC
CTTGGTGGAGCTGCTCTGA

hide sequence

RefSeq Acc Id:

XM_063278261 ⟹ XP_063134331

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	64,432,524 - 64,468,852 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178938	(Get FASTA)	NCBI Sequence Viewer
	XP_063134331	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL92669	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000038726.5
	ENSRNOP00000102529
	ENSRNOP00000102529.1

RefSeq Acc Id:

NP_001178938 ⟸ NM_001192009

- UniProtKB:

D4A0Y7 (UniProtKB/TrEMBL), A6IZJ1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEGQTRGSRGLPEKPLPATTHPPLSSLGAVFILLKSALGAGLLNFPWAFYKAGGLVPTFLVALV
SLVFLISGLVILGYAASVSGQTTYQGVVRELCGPAMGKLCEACFLTNLLMISVAFLRVIGDQLE
KLCDSLLPDAPQPWYAAQSFTLPLISVLVIFPLSALRDIALQEYTSILGTLAACYLALVITVQY
YLWPQGLIRQPGPLLSPSPWTSVFSVFPTICFGFQCHEAAVSIYCSMQNQSLPHWTLVSVLSLM
ACCLVYTLTGVYGFLTFGTEVSADILMSYPGNDTAIIVARVLFAVSIVTVYPIVLFLGRSVMQD
FWKKSYWATQGSPVLADPSGPWVRLPLTFLWVAVTLAMALFLPDLSEIIGVIGGLSAFFIFIFP
GLCLISAVDTEPIGPRVKCCLEAWGTLSVLLGTFVFGQSTAGALVELL

hide sequence

Ensembl Acc Id:

ENSRNOP00000038726 ⟸ ENSRNOT00000038580

RefSeq Acc Id:	XP_063134331 ⟸ XM_063278261
- Peptide Label:	isoform X1
- UniProtKB:	D4A0Y7 (UniProtKB/TrEMBL), A6IZJ1 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000102529 ⟸ ENSRNOT00000171668

Protein Domains

Amino acid transporter transmembrane

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A0Y7-F1-model_v2	AlphaFold	D4A0Y7	1-432	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1560237	AgrOrtholog
BioCyc Gene	G2FUF-5516	BioCyc
Ensembl Genes	ENSRNOG00000025503	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000038580.6	UniProtKB/TrEMBL
	ENSRNOT00000171668	ENTREZGENE
	ENSRNOT00000171668.1	UniProtKB/TrEMBL
Gene3D-CATH	Amino acid/polyamine transporter I	UniProtKB/TrEMBL
InterPro	AA_transpt_TM	UniProtKB/TrEMBL
KEGG Report	rno:502208	UniProtKB/TrEMBL
NCBI Gene	502208	ENTREZGENE
PANTHER	AMINO ACID TRANSPORTER	UniProtKB/TrEMBL
	SODIUM-COUPLED NEUTRAL AMINO ACID TRANSPORTER 8-RELATED	UniProtKB/TrEMBL
Pfam	Aa_trans	UniProtKB/TrEMBL
PhenoGen	Slc38a8	PhenoGen
RatGTEx	ENSRNOG00000025503	RatGTEx
UniProt	A0ABK0LHW9_RAT	UniProtKB/TrEMBL
	A6IZJ1	ENTREZGENE, UniProtKB/TrEMBL
	D4A0Y7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-11	Slc38a8	solute carrier family 38, member 8	RGD1560237_predicted	similar to Gene model 587 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1560237_predicted	similar to Gene model 587 (predicted)	LOC502208	similar to Gene model 587	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC502208	similar to Gene model 587			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM