Advanced Search (OLGA)

Gene: Rbfox3 (RNA binding fox-1 homolog 3) Rattus norvegicus

Analyze

Symbol:

Rbfox3

Name:

RNA binding fox-1 homolog 3

RGD ID:

1560070

Description:

Predicted to enable DNA binding activity and mRNA binding activity. Predicted to be involved in nervous system development and regulation of alternative mRNA splicing, via spliceosome. Predicted to be located in perikaryon. Predicted to be active in cytoplasm and nucleus. Biomarker of brain infarction and middle cerebral artery infarction. Orthologous to human RBFOX3 (RNA binding fox-1 homolog 3); INTERACTS WITH 1-bromopropane; 17beta-estradiol; 2,3,7,8-Tetrachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

fox-1 homolog C; hexaribonucleotide binding protein 3; Hrnbp3; hypothetical protein LOC287847; LOC287847; Neun; neuronal nuclei; RGD1560070; RNA binding protein fox-1 homolog 3; RNA binding protein, fox-1 homolog (C. elegans) 3; RNA binding protein, fox-1 homolog 3; similar to ataxin 2-binding protein 1 isoform 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RBFOX3 (RNA binding fox-1 homolog 3)	HGNC	Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Rbfox3 (RNA binding protein, fox-1 homolog (C. elegans) 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rbfox3 (RNA binding fox-1 homolog 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RBFOX3 (RNA binding fox-1 homolog 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RBFOX3 (RNA binding fox-1 homolog 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rbfox3 (RNA binding fox-1 homolog 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RBFOX3 (RNA binding fox-1 homolog 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RBFOX3 (RNA binding fox-1 homolog 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rbfox3 (RNA binding fox-1 homolog 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rbfox3 (RNA binding fox-1 homolog 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RBFOX3 (RNA binding fox-1 homolog 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rbfox3 (RNA binding protein, fox-1 homolog (C. elegans) 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rbfox3b (RNA binding fox-1 homolog 3b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	rbfox3b (RNA binding fox-1 homolog 3b)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	rbfox3a (RNA binding fox-1 homolog 3a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rbfox3a (RNA binding fox-1 homolog 3a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	asd-1	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rbfox1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	Rbfox1	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	fox-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	fox-1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rbfox3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rbfox3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	104,218,940 - 104,655,863 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	104,218,940 - 104,551,945 (-)	Ensembl				GRCr8
mRatBN7.2	10	103,720,355 - 104,157,277 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	103,720,636 - 104,156,935 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	108,824,453 - 108,845,549 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	108,287,495 - 108,308,590 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	103,643,946 - 103,665,198 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	107,517,916 - 107,850,764 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	107,516,995 - 107,539,658 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	107,150,696 - 107,577,314 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	108,492,172 - 108,635,296 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	102,283,623 - 102,304,489 (-)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

benign epilepsy with centrotemporal spikes (ISO)

brain infarction (IEP)

generalized epilepsy (ISO)

Idiopathic Generalized Epilepsy (ISO)

middle cerebral artery infarction (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-cotinine (ISO)

(S)-nicotine (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-bromopropane (EXP)

17beta-estradiol (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3',5'-cyclic AMP (ISO)

3-methyladenine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

9-cis-retinoic acid (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

amphetamine (ISO)

antimony(0) (ISO)

aripiprazole (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (EXP)

azithromycin (ISO)

BAPTA (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (ISO)

Calcitonin gene-related peptide 1 (EXP)

carbofuran (EXP)

carbon nanotube (ISO)

chlordecone (ISO)

chloroprene (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) chloride (ISO)

Diallyl sulfide (EXP)

dieldrin (ISO)

diethyl hydrogen phosphate (ISO)

diisopropyl fluorophosphate (EXP)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

diuron (EXP)

dorsomorphin (ISO)

elemental selenium (ISO)

entinostat (ISO)

ethanol (ISO)

fenvalerate (EXP)

folic acid (ISO)

genistein (ISO)

L-ascorbic acid (ISO)

lead diacetate (EXP,ISO)

lead(0) (EXP,ISO)

Licochalcone B (ISO)

mercury atom (ISO)

mercury dibromide (ISO)

mercury(0) (ISO)

methamphetamine (ISO)

methapyrilene (ISO)

methimazole (EXP)

methotrexate (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

minocycline (ISO)

N-methyl-4-phenylpyridinium (ISO)

nicotine (ISO)

Nonylphenol (EXP)

ozone (EXP,ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paraquat (ISO)

pexidartinib (ISO)

phenylmercury acetate (ISO)

resveratrol (EXP)

rotenone (ISO)

SB 431542 (EXP,ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sterigmatocystin (EXP)

testosterone (EXP,ISO)

Theaflavin 3,3'-digallate (ISO)

thimerosal (ISO)

thymoquinone (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

mRNA processing (IEA)

nervous system development (IBA,IEA)

regulation of alternative mRNA splicing, via spliceosome (IBA,IEA,ISO)

regulation of RNA splicing (IEA)

RNA splicing (IEA)

Cellular Component

cytoplasm (IBA,ISO)

neuronal cell body (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

perikaryon (IEA,ISO)

Molecular Function

DNA binding (IEA,ISO)

mRNA binding (IBA)

nucleic acid binding (IEA)

protein binding (ISO)

RNA binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Neuronal replacement from endogenous precursors in the adult brain after stroke.	Arvidsson A, etal., Nat Med. 2002 Sep;8(9):963-70. doi: 10.1038/nm747. Epub 2002 Aug 5.
2.	Intranasal Calcitonin Gene-Related Peptide Protects Against Focal Cerebral Ischemic Injury in Rats Through the Wnt/β-Catenin Pathway.	Du Z, etal., Med Sci Monit. 2018 Dec 7;24:8860-8869. doi: 10.12659/MSM.913777.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1483388	PMID:15148382	PMID:15964665	PMID:16314515	PMID:17018287	PMID:17301088	PMID:17606467	PMID:19646951	PMID:19682546	PMID:20418887	PMID:20452351	PMID:20578039
PMID:21172456	PMID:21747913	PMID:23447615	PMID:23836929	PMID:23877069	PMID:24367100	PMID:25798055	PMID:25834037	PMID:26987225	PMID:27487661	PMID:34146639

Genomics

Comparative Map Data

Rbfox3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	104,218,940 - 104,655,863 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	104,218,940 - 104,551,945 (-)	Ensembl				GRCr8
mRatBN7.2	10	103,720,355 - 104,157,277 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	103,720,636 - 104,156,935 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	108,824,453 - 108,845,549 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	108,287,495 - 108,308,590 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	103,643,946 - 103,665,198 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	107,517,916 - 107,850,764 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	107,516,995 - 107,539,658 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	107,150,696 - 107,577,314 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	108,492,172 - 108,635,296 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	102,283,623 - 102,304,489 (-)	NCBI		Celera
Cytogenetic Map	10	q32.3	NCBI

RBFOX3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	79,089,345 - 79,665,571 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	79,089,345 - 79,611,258 (-)	Ensembl			hg38	GRCh38
GRCh37	17	77,085,427 - 77,632,826 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	74,743,415 - 74,931,797 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	17	73,683,652 - 74,076,296 (-)	NCBI		Celera
Cytogenetic Map	17	q25.3	NCBI
HuRef	17	72,508,346 - 72,935,630 (-)	NCBI		HuRef
CHM1_1	17	77,149,351 - 77,576,178 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	79,984,286 - 80,563,418 (-)	NCBI		T2T-CHM13v2.0

Rbfox3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	118,380,586 - 118,802,423 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	118,380,588 - 118,802,423 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	118,489,760 - 118,911,597 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	118,489,762 - 118,911,597 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	118,351,074 - 118,770,886 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	118,305,850 - 118,725,662 (-)	NCBI		MGSCv36	mm8
Celera	11	130,235,488 - 130,656,656 (-)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	83.22	NCBI

Rbfox3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955506	3,624,378 - 3,646,789 (+)	Ensembl
ChiLan1.0	NW_004955506	3,243,637 - 3,646,789 (+)	NCBI	ChiLan1.0	ChiLan1.0

RBFOX3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	95,136,350 - 95,664,449 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	99,966,424 - 100,493,350 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	73,163,818 - 73,690,675 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	78,711,056 - 79,099,721 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	78,711,056 - 78,732,131 (-)	Ensembl			panPan2	panpan1.1

RBFOX3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	2,362,354 - 2,374,492 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	2,362,231 - 2,372,739 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	2,584,621 - 3,030,199 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	2,577,342 - 3,023,588 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	2,906,484 - 3,023,598 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	2,600,496 - 3,046,030 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	2,726,153 - 3,171,835 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	2,807,110 - 3,252,747 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rbfox3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	2,997,298 - 3,017,367 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	3,393,666 - 3,414,628 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	3,393,675 - 3,744,755 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RBFOX3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	3,116,773 - 3,138,840 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	3,116,769 - 3,138,846 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

RBFOX3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	71,058,257 - 71,673,053 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	71,058,131 - 71,276,475 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666077	42,319,760 - 42,874,640 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rbfox3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	8,404,285 - 8,424,652 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624801	8,404,271 - 8,795,695 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rbfox3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	65,134,292 - 65,572,828 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rbfox3
3524 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	65
Count of miRNA genes:	57
Interacting mature miRNAs:	60
Transcripts:	ENSRNOT00000004524
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	65390777	107713808	Rat
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93723381	107556066	Rat
8657410	Bp374	Blood pressure QTL 374			heart left ventricle size trait (VT:0002753)	heart left ventricle end-diastolic diameter (CMO:0000982)	10	67476608	107713808	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63719161	107713808	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
12903252	Cm113	Cardiac mass QTL 113		0.047	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68920187	107713808	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	64939013	107713808	Rat
1358915	Stresp7	Stress response QTL 7	3.52		blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	65307813	107713808	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76951790	107713808	Rat
70168	Eae12	Experimental allergic encephalomyelitis QTL 12		0.0009	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	73599825	107713808	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	89039175	107713808	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70698731	107713808	Rat
12903269	Am15	Aortic mass QTL 15		0.042	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
12903266	Cm114	Cardiac mass QTL 114		0.02	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	66817119	107713808	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	97202388	107556066	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96620293	107713808	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1581559	Eae18	Experimental allergic encephalomyelitis QTL 18		0.00002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	66108888	107555881	Rat
12880372	Am12	Aortic mass QTL 12		0.003	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	66817119	107713808	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
12880375	Kidm66	Kidney mass QTL 66		0.009	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87807758	107713808	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
12880370	Cm105	Cardiac mass QTL 105		0.008	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
12880371	Cm106	Cardiac mass QTL 106		0.007	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	66817119	107713808	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72724423	107713808	Rat
631537	Oia4	Oil induced arthritis QTL 4			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	76128947	107713808	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	91127270	107556066	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91727883	107713808	Rat
11565453	Kidm58	Kidney mass QTL 58		0.002	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	66817119	107713808	Rat
2301405	Cm69	Cardiac mass QTL 69		0.031	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	66817119	107713808	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	97202388	107556066	Rat

Markers in Region

D10Rat134

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	103,784,905 - 103,785,112 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	107,579,840 - 107,580,046	NCBI	Rnor6.0
Rnor_5.0	10	107,214,772 - 107,214,978	UniSTS	Rnor5.0
RGSC_v3.4	10	108,557,381 - 108,557,588	RGD	RGSC3.4
RGSC_v3.4	10	108,557,382 - 108,557,588	UniSTS	RGSC3.4
Celera	10	102,344,864 - 102,345,070	UniSTS
RGSC_v3.1	10	108,571,885 - 108,572,092	RGD
SHRSP x BN Map	10	92.75	RGD
SHRSP x BN Map	10	92.75	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

D10Arb22

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	104,060,133 - 104,060,283 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	107,857,524 - 107,857,673	NCBI	Rnor6.0
Rnor_5.0	10	107,484,612 - 107,484,761	UniSTS	Rnor5.0
Celera	10	102,615,292 - 102,615,441	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

D10Wox32

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	104,060,093 - 104,060,279 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	107,857,484 - 107,857,669	NCBI	Rnor6.0
Rnor_5.0	10	107,484,572 - 107,484,757	UniSTS	Rnor5.0
Celera	10	102,615,252 - 102,615,437	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

D10Got224

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	104,149,673 - 104,149,816 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	107,947,311 - 107,947,453	NCBI	Rnor6.0
Rnor_5.0	10	107,570,952 - 107,571,094	UniSTS	Rnor5.0
Celera	10	102,702,890 - 102,703,032	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

AU047523

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	10	104,569,966 - 104,570,141 (+)	Marker Load Pipeline
mRatBN7.2	10	104,071,393 - 104,071,568 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	107,868,812 - 107,868,987	NCBI	Rnor6.0
Rnor_5.0	10	107,495,900 - 107,496,075	UniSTS	Rnor5.0
Celera	10	102,626,561 - 102,626,739	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

AI228530

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	103,835,819 - 103,836,072 (+)	MAPPER	mRatBN7.2
mRatBN7.2	18	25,951,336 - 25,951,586 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	27,134,422 - 27,134,671	NCBI	Rnor6.0
Rnor_6.0	10	107,631,211 - 107,631,463	NCBI	Rnor6.0
Rnor_5.0	18	26,847,961 - 26,848,210	UniSTS	Rnor5.0
Rnor_5.0	10	107,265,698 - 107,265,950	UniSTS	Rnor5.0
RGSC_v3.4	10	108,608,479 - 108,608,731	UniSTS	RGSC3.4
RGSC_v3.4	18	26,819,849 - 26,820,098	UniSTS	RGSC3.4
Celera	18	25,692,430 - 25,692,679	UniSTS
Celera	10	102,395,754 - 102,396,006	UniSTS
RH 3.4 Map	18	346.4	UniSTS
Cytogenetic Map	10	q32.3	UniSTS
Cytogenetic Map	18	p12	UniSTS

D2S147

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	103,878,082 - 103,879,235 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	107,672,500 - 107,673,652	NCBI	Rnor6.0
Rnor_5.0	10	107,306,741 - 107,307,893	UniSTS	Rnor5.0
RGSC_v3.4	10	108,650,504 - 108,651,656	UniSTS	RGSC3.4
Celera	10	102,436,303 - 102,437,455	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	9	67	158	86	85	57	34	57	6	275	132	10	130	65	92	28	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001134498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001413230	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085677	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085678	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085679	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085682	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085683	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085684	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268784	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010055159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010055160	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010055161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213090	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000004524 ⟹ ENSRNOP00000004524

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	104,218,940 - 104,551,945 (-)	Ensembl
mRatBN7.2 Ensembl	10	103,723,278 - 104,156,935 (-)	Ensembl
Rnor_6.0 Ensembl	10	107,518,744 - 107,539,465 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089346 ⟹ ENSRNOP00000072266

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	103,721,541 - 104,156,935 (-)	Ensembl
Rnor_6.0 Ensembl	10	107,516,995 - 107,539,658 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000120132 ⟹ ENSRNOP00000091761

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	104,219,417 - 104,551,945 (-)	Ensembl
mRatBN7.2 Ensembl	10	103,720,636 - 104,156,935 (-)	Ensembl

RefSeq Acc Id:

NM_001134498 ⟹ NP_001127970

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,218,940 - 104,655,544 (-)	NCBI
mRatBN7.2	10	103,720,355 - 104,156,965 (-)	NCBI
Rnor_6.0	10	107,518,744 - 107,539,465 (-)	NCBI
Rnor_5.0	10	107,150,696 - 107,577,314 (-)	NCBI
RGSC_v3.4	10	108,492,172 - 108,635,296 (-)	RGD
Celera	10	102,283,623 - 102,304,489 (-)	NCBI

Sequence:

show sequence

ATGGCCCAGCCCTACCCCCCTGCCCAGTACCCTCCTCCACCTCAGAATGGAATCCCAGCTGAAT
ATGCCCCACCTCCGCCACATCCCACACAGGACTACTCCGGCCAGACCCCCGTCCCCCCAGAGCA
CGGCATGACCCTCTACACGCCAGCACAGACGCATCCTGAGCAGCCGGGCACTGAGGCCAGCACA
CAGCCCATCGCTGGGACCCAGACGGTGCCGCAGGCAGATGAAGCAGCACAGACAGATAGCCAGC
AACTCCACCCTTCCGACCCCACGGAGAAGCAGCAGCCCAAACGACTACATGTCTCCAACATCCC
CTTCCGGTTCAGGGACCCCGACCTGCGGCAAATGTTCGGGCAATTCGGGAAAATTTTAGACGTG
GAGATCATTTTTAACGAGCGGGGCTCCAAGGGTTTTGGGTTTGTAACTTTTGAAACTAGCTCAG
ATGCTGACCGAGCCCGGGAGAAGCTGAATGGGACGATCGTAGAGGGACGGAAAATTGAGGTCAA
TAATGCCACGGCCCGGGTCATGACCAATAAGAAGCCTGGGAACCCATATGCCAATGGCTGGAAG
CTAAACCCTGTGGTAGGAGCAGTCTATGGGCCCGAATTCTATGCAGTGACCAGTTTCCCCTACC
CCACCACGGGCACCGCCGTCGCCTATCGGGGTGCGCACCTGCGGGGCCGGGGCCGTGCTGTGTA
TAATACATTTCGAGCTGCACCACCTCCGCCCCCCATTCCAACTTACGGAGCGGCACTGGAGCAA
ACGCTTGTTAAAATGCCAGTCCCGTGGGCGGGGCTGGCACCGTGCCCCCTCCCTCCTCAGCAGA
CACCGGAGCCGGCCTACCCCACCTCTCCAGCGTTCCCACCACTCTCTTGTCCGTTTGCTTCCAG
GGTCGTGTATCAGGATGGATTTTATGGTGCTGAGATTTATGGAGGCTATGCAGCTTACAGATAT
GCTCAGCCAGCAGCAGCAGCTGCCGCCGCAGCCTACAGTGACAGTTATGGTAGAGTCTATGCGG
CTGCTGATCCCTACCATCATACCATCGGCCCCACAGCAACCTACAGCATCGGAACCATGGCTAG
CCTCTGCCGAGGAGGGTACAGCCGCTTCACCCCCTACTAG

hide sequence

RefSeq Acc Id:

NM_001413230 ⟹ NP_001400159

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,218,940 - 104,655,544 (-)	NCBI
mRatBN7.2	10	103,720,355 - 104,156,965 (-)	NCBI

RefSeq Acc Id:

XM_039085677 ⟹ XP_038941605

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,221,270 - 104,301,743 (-)	NCBI
mRatBN7.2	10	103,722,685 - 103,803,103 (-)	NCBI

RefSeq Acc Id:

XM_039085678 ⟹ XP_038941606

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,221,270 - 104,301,743 (-)	NCBI
mRatBN7.2	10	103,722,685 - 103,803,111 (-)	NCBI

RefSeq Acc Id:

XM_039085679 ⟹ XP_038941607

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,218,940 - 104,301,743 (-)	NCBI
mRatBN7.2	10	103,720,355 - 103,803,099 (-)	NCBI

RefSeq Acc Id:

XM_039085682 ⟹ XP_038941610

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,221,270 - 104,301,743 (-)	NCBI
mRatBN7.2	10	103,722,685 - 103,803,101 (-)	NCBI

RefSeq Acc Id:

XM_039085683 ⟹ XP_038941611

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,221,270 - 104,301,743 (-)	NCBI
mRatBN7.2	10	103,722,685 - 103,803,110 (-)	NCBI

RefSeq Acc Id:

XM_039085684 ⟹ XP_038941612

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,218,940 - 104,301,743 (-)	NCBI
mRatBN7.2	10	103,720,355 - 103,803,096 (-)	NCBI

RefSeq Acc Id:

XM_063268783 ⟹ XP_063124853

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,225,582 - 104,301,743 (-)	NCBI

RefSeq Acc Id:

XM_063268784 ⟹ XP_063124854

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,225,582 - 104,301,743 (-)	NCBI

RefSeq Acc Id:

XM_063268785 ⟹ XP_063124855

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,225,582 - 104,655,858 (-)	NCBI

RefSeq Acc Id:

XM_063268786 ⟹ XP_063124856

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,225,582 - 104,655,863 (-)	NCBI

RefSeq Acc Id:

XM_063268787 ⟹ XP_063124857

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,225,582 - 104,655,858 (-)	NCBI

RefSeq Acc Id:

XR_010055159

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,243,018 - 104,633,996 (-)	NCBI

RefSeq Acc Id:

XR_010055160

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,383,044 - 104,633,996 (-)	NCBI

RefSeq Acc Id:

XR_010055161

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	104,539,090 - 104,633,996 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001127970	(Get FASTA)	NCBI Sequence Viewer
	NP_001400159	(Get FASTA)	NCBI Sequence Viewer
	XP_038941605	(Get FASTA)	NCBI Sequence Viewer
	XP_038941606	(Get FASTA)	NCBI Sequence Viewer
	XP_038941607	(Get FASTA)	NCBI Sequence Viewer
	XP_038941610	(Get FASTA)	NCBI Sequence Viewer
	XP_038941611	(Get FASTA)	NCBI Sequence Viewer
	XP_038941612	(Get FASTA)	NCBI Sequence Viewer
	XP_063124853	(Get FASTA)	NCBI Sequence Viewer
	XP_063124854	(Get FASTA)	NCBI Sequence Viewer
	XP_063124855	(Get FASTA)	NCBI Sequence Viewer
	XP_063124856	(Get FASTA)	NCBI Sequence Viewer
	XP_063124857	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM06767	(Get FASTA)	NCBI Sequence Viewer
	EDM06768	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000004524
	ENSRNOP00000004524.4
	ENSRNOP00000091761.2

RefSeq Acc Id:	NP_001127970 ⟸ NM_001134498
- Peptide Label:	isoform 2
- UniProtKB:	D4A2H6 (UniProtKB/TrEMBL), A6HL63 (UniProtKB/TrEMBL), A6HL62 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPPEHGMTLYTPAQTHPEQPGTEAST QPIAGTQTVPQADEAAQTDSQQLHPSDPTEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDV EIIFNERGSKGFGFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARVMTNKKPGNPYANGWK LNPVVGAVYGPEFYAVTSFPYPTTGTAVAYRGAHLRGRGRAVYNTFRAAPPPPPIPTYGAALEQ TLVKMPVPWAGLAPCPLPPQQTPEPAYPTSPAFPPLSCPFASRVVYQDGFYGAEIYGGYAAYRY AQPAAAAAAAAYSDSYGRVYAAADPYHHTIGPTATYSIGTMASLCRGGYSRFTPY hide sequence

Ensembl Acc Id:

ENSRNOP00000004524 ⟸ ENSRNOT00000004524

Ensembl Acc Id:

ENSRNOP00000072266 ⟸ ENSRNOT00000089346

RefSeq Acc Id:	XP_038941607 ⟸ XM_039085679
- Peptide Label:	isoform X5

RefSeq Acc Id:	XP_038941612 ⟸ XM_039085684
- Peptide Label:	isoform X9
- UniProtKB:	A6HL62 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038941606 ⟸ XM_039085678
- Peptide Label:	isoform X4

RefSeq Acc Id:	XP_038941611 ⟸ XM_039085683
- Peptide Label:	isoform X8
- UniProtKB:	A6HL62 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038941605 ⟸ XM_039085677
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038941610 ⟸ XM_039085682
- Peptide Label:	isoform X7
- UniProtKB:	A6HL62 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000091761 ⟸ ENSRNOT00000120132

RefSeq Acc Id:	NP_001400159 ⟸ NM_001413230
- Peptide Label:	isoform 1
- UniProtKB:	A6HL62 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063124856 ⟸ XM_063268786
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_063124857 ⟸ XM_063268787
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_063124855 ⟸ XM_063268785
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_063124854 ⟸ XM_063268784
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_063124853 ⟸ XM_063268783
- Peptide Label:	isoform X1

Protein Domains

RRM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A2H6-F1-model_v2	AlphaFold	D4A2H6	1-375	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1560070	AgrOrtholog
BioCyc Gene	G2FUF-22511	BioCyc
Ensembl Genes	ENSRNOG00000003386	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000004524	ENTREZGENE
	ENSRNOT00000004524.7	UniProtKB/TrEMBL
	ENSRNOT00000120132.2	UniProtKB/TrEMBL
Gene3D-CATH	3.30.70.330	UniProtKB/TrEMBL
InterPro	Fox-1_C_dom	UniProtKB/TrEMBL
	FOX1_RRM	UniProtKB/TrEMBL
	Nucleotide-bd_a/b_plait_sf	UniProtKB/TrEMBL
	RBD_domain_sf	UniProtKB/TrEMBL
	RBFOX1-like	UniProtKB/TrEMBL
	RNA-bd_9/Ataxin-2-bd	UniProtKB/TrEMBL
	RRM_RNP1	UniProtKB/TrEMBL
KEGG Report	rno:287847	UniProtKB/TrEMBL
NCBI Gene	287847	ENTREZGENE
PANTHER	ATAXIN 2-BINDING PROTEIN 1-RELATED	UniProtKB/TrEMBL
	RNA BINDING PROTEIN FOX-1 HOMOLOG 3	UniProtKB/TrEMBL
Pfam	Fox-1_C	UniProtKB/TrEMBL
	RRM_1	UniProtKB/TrEMBL
PhenoGen	Rbfox3	PhenoGen
PIRSF	Ataxin_2_bd_A2BP	UniProtKB/TrEMBL
PROSITE	RRM	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000003386	RatGTEx
SMART	RRM	UniProtKB/TrEMBL
Superfamily-SCOP	SSF54928	UniProtKB/TrEMBL
UniProt	A0A8I6AGR7_RAT	UniProtKB/TrEMBL
	A6HL62	ENTREZGENE, UniProtKB/TrEMBL
	A6HL63	ENTREZGENE, UniProtKB/TrEMBL
	D4A2H6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-09-28	Rbfox3	RNA binding fox-1 homolog 3	Rbfox3	RNA binding protein, fox-1 homolog 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-04-27	Rbfox3	RNA binding protein, fox-1 homolog 3	Rbfox3	RNA binding protein, fox-1 homolog (C. elegans) 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-02	Rbfox3	RNA binding protein, fox-1 homolog (C. elegans) 3	Hrnbp3	hexaribonucleotide binding protein 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-04-23	Hrnbp3	hexaribonucleotide binding protein 3	RGD1560070	similar to ataxin 2-binding protein 1 isoform 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1560070	similar to ataxin 2-binding protein 1 isoform 2	RGD1560070_predicted	similar to ataxin 2-binding protein 1 isoform 2 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1560070_predicted	similar to ataxin 2-binding protein 1 isoform 2 (predicted)	LOC287847	similar to ataxin 2-binding protein 1 isoform 2	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC287847	similar to ataxin 2-binding protein 1 isoform 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar