Symbol:
Dusp3
Name:
dual specificity phosphatase 3
RGD ID:
1560049
Description:
Predicted to enable cytoskeletal protein binding activity; phosphoprotein phosphatase activity; and receptor tyrosine kinase binding activity. Involved in in utero embryonic development. Predicted to be located in immunological synapse and nucleoplasm. Predicted to be active in axonemal microtubule doublet inner sheath; cytosol; and sperm flagellum. Orthologous to human DUSP3 (dual specificity phosphatase 3); PARTICIPATES IN mitogen activated protein kinase signaling pathway; INTERACTS WITH 1,2-dimethylhydrazine; 2,3,7,8-tetrachlorodibenzodioxine; 3,4-methylenedioxymethamphetamine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related); dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related)-like; dual specificity protein phosphatase 3; LOC100365414; LOC498003; MGC189429; RGD1560049; similar to Dual specificity protein phosphatase 3 (T-DSP11); vaccinia virus phosphatase VH1-related
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 87,420,213 - 87,434,202 (-) NCBI GRCr8 mRatBN7.2 10 86,920,014 - 86,933,739 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 86,920,014 - 86,933,962 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 91,949,402 - 91,961,231 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 91,425,015 - 91,436,834 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 86,818,327 - 86,830,145 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 89,904,578 - 89,918,296 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 89,904,560 - 89,918,427 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 89,697,004 - 89,710,720 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 91,031,206 - 91,044,858 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 85,639,184 - 85,651,010 (-) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dusp3 Rat 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of DUSP3 mRNA CTD PMID:27840820 Dusp3 Rat 1,2-dimethylhydrazine increases expression ISO Dusp3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of DUSP3 mRNA CTD PMID:22206623 Dusp3 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO DUSP3 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to DUSP3 protein CTD PMID:32991956 Dusp3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Dusp3 (Mus musculus) 6480464 AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of DUSP3 mRNA] CTD PMID:15034205 Dusp3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DUSP3 mRNA CTD PMID:33387578 Dusp3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of DUSP3 mRNA CTD PMID:34747641 Dusp3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dusp3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DUSP3 mRNA CTD PMID:21570461 and PMID:24680724 Dusp3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Dusp3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DUSP3 mRNA CTD PMID:15034205 Dusp3 Rat 2-methylcholine affects expression ISO DUSP3 (Homo sapiens) 6480464 beta-methylcholine affects the expression of DUSP3 mRNA CTD PMID:21179406 Dusp3 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of DUSP3 mRNA CTD PMID:30071829 Dusp3 Rat 5-aza-2'-deoxycytidine affects expression ISO DUSP3 (Homo sapiens) 6480464 Decitabine affects the expression of DUSP3 mRNA CTD PMID:23300844 Dusp3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DUSP3 mRNA CTD PMID:30047161 Dusp3 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of DUSP3 mRNA CTD PMID:28959563 Dusp3 Rat acrylamide increases expression ISO DUSP3 (Homo sapiens) 6480464 Acrylamide results in increased expression of DUSP3 mRNA CTD PMID:32763439 Dusp3 Rat aflatoxin B1 increases methylation ISO DUSP3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of DUSP3 gene CTD PMID:27153756 Dusp3 Rat all-trans-retinoic acid decreases expression ISO DUSP3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of DUSP3 mRNA CTD PMID:33167477 Dusp3 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of DUSP3 mRNA CTD PMID:30047161 Dusp3 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of DUSP3 mRNA CTD PMID:30779732 Dusp3 Rat arsane increases methylation ISO DUSP3 (Homo sapiens) 6480464 Arsenic results in increased methylation of DUSP3 promoter CTD PMID:21291286 Dusp3 Rat arsenic atom increases methylation ISO DUSP3 (Homo sapiens) 6480464 Arsenic results in increased methylation of DUSP3 promoter CTD PMID:21291286 Dusp3 Rat arsenite(3-) increases expression ISO Dusp3 (Mus musculus) 6480464 arsenite results in increased expression of DUSP3 protein CTD PMID:37955338 Dusp3 Rat benzo[a]pyrene multiple interactions ISO Dusp3 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of DUSP3 mRNA] and AHR protein inhibits the reaction [Benzo(a)pyrene results in decreased expression of DUSP3 mRNA] CTD PMID:15034205 and PMID:22228805 Dusp3 Rat benzo[a]pyrene affects methylation ISO DUSP3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DUSP3 promoter CTD PMID:27901495 Dusp3 Rat benzo[a]pyrene increases expression ISO DUSP3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of DUSP3 mRNA and Benzo(a)pyrene results in increased expression of DUSP3 protein CTD PMID:26238291 and PMID:33278487 Dusp3 Rat benzo[a]pyrene decreases expression ISO Dusp3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of DUSP3 mRNA CTD PMID:15034205 Dusp3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Dusp3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of DUSP3 mRNA CTD PMID:34319233 Dusp3 Rat bisphenol A increases expression ISO Dusp3 (Mus musculus) 6480464 bisphenol A results in increased expression of DUSP3 mRNA CTD PMID:26063408 Dusp3 Rat bisphenol A increases expression ISO DUSP3 (Homo sapiens) 6480464 bisphenol A results in increased expression of DUSP3 protein CTD PMID:37567409 Dusp3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DUSP3 mRNA CTD PMID:30816183 more ... Dusp3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of DUSP3 gene CTD PMID:28505145 Dusp3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DUSP3 mRNA CTD PMID:25181051 Dusp3 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of DUSP3 protein CTD PMID:28903499 Dusp3 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of DUSP3 mRNA CTD PMID:19167457 Dusp3 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of DUSP3 mRNA CTD PMID:33453195 Dusp3 Rat captan decreases expression ISO Dusp3 (Mus musculus) 6480464 Captan results in decreased expression of DUSP3 mRNA CTD PMID:31558096 Dusp3 Rat carbon nanotube decreases expression ISO Dusp3 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of DUSP3 mRNA CTD PMID:25554681 Dusp3 Rat CGP 52608 multiple interactions ISO DUSP3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DUSP3 gene] CTD PMID:28238834 Dusp3 Rat chlorpyrifos increases expression ISO Dusp3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of DUSP3 mRNA CTD PMID:37019170 Dusp3 Rat chrysene decreases expression ISO Dusp3 (Mus musculus) 6480464 chrysene results in decreased expression of DUSP3 mRNA CTD PMID:26377693 Dusp3 Rat cisplatin affects expression ISO DUSP3 (Homo sapiens) 6480464 Cisplatin affects the expression of DUSP3 mRNA CTD PMID:23300844 Dusp3 Rat copper atom multiple interactions ISO DUSP3 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of DUSP3 mRNA CTD PMID:30911355 Dusp3 Rat copper(0) multiple interactions ISO DUSP3 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of DUSP3 mRNA CTD PMID:30911355 Dusp3 Rat cumene multiple interactions ISO Dusp3 (Mus musculus) 6480464 [cumene co-treated with KRAS gene mutant form] results in decreased expression of DUSP3 mRNA CTD PMID:18648096 Dusp3 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of DUSP3 mRNA CTD PMID:27523638 Dusp3 Rat cyclosporin A increases expression ISO DUSP3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of DUSP3 mRNA CTD PMID:25562108 Dusp3 Rat cyproconazole increases expression ISO Dusp3 (Mus musculus) 6480464 cyproconazole results in increased expression of DUSP3 mRNA CTD PMID:22334560 Dusp3 Rat DDE decreases expression ISO DUSP3 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of DUSP3 mRNA CTD PMID:38568856 Dusp3 Rat deguelin increases expression ISO DUSP3 (Homo sapiens) 6480464 deguelin results in increased expression of DUSP3 mRNA CTD PMID:33512557 Dusp3 Rat diazinon increases methylation ISO DUSP3 (Homo sapiens) 6480464 Diazinon results in increased methylation of DUSP3 gene CTD PMID:22964155 Dusp3 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of DUSP3 mRNA CTD PMID:21266533 Dusp3 Rat dibutyl phthalate increases expression ISO Dusp3 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of DUSP3 mRNA CTD PMID:21266533 Dusp3 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of DUSP3 mRNA CTD PMID:24893172 Dusp3 Rat dorsomorphin multiple interactions ISO DUSP3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DUSP3 mRNA CTD PMID:27188386 Dusp3 Rat epoxiconazole increases expression ISO Dusp3 (Mus musculus) 6480464 epoxiconazole results in increased expression of DUSP3 mRNA CTD PMID:22334560 Dusp3 Rat ethanol affects splicing ISO Dusp3 (Mus musculus) 6480464 Ethanol affects the splicing of DUSP3 mRNA CTD PMID:30319688 Dusp3 Rat fenthion decreases expression ISO Dusp3 (Mus musculus) 6480464 Fenthion results in decreased expression of DUSP3 mRNA CTD PMID:34813904 Dusp3 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of DUSP3 mRNA CTD PMID:24136188 Dusp3 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of DUSP3 mRNA CTD PMID:24136188 Dusp3 Rat folpet decreases expression ISO Dusp3 (Mus musculus) 6480464 folpet results in decreased expression of DUSP3 mRNA CTD PMID:31558096 Dusp3 Rat gefitinib affects response to substance ISO DUSP3 (Homo sapiens) 6480464 DUSP3 protein affects the susceptibility to gefitinib CTD PMID:15496427 Dusp3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of DUSP3 mRNA CTD PMID:22061828 and PMID:33387578 Dusp3 Rat indinavir multiple interactions ISO Dusp3 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of DUSP3 mRNA CTD PMID:16931933 Dusp3 Rat ivermectin decreases expression ISO DUSP3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of DUSP3 protein CTD PMID:32959892 Dusp3 Rat L-methionine multiple interactions ISO DUSP3 (Homo sapiens) 6480464 [Methionine co-treated with Sorafenib] results in increased expression of DUSP3 mRNA CTD PMID:38367245 Dusp3 Rat L-methionine multiple interactions EXP 6480464 [Sorafenib co-treated with Methionine] inhibits the reaction [Diethylnitrosamine results in decreased expression of DUSP3 mRNA] CTD PMID:38367245 Dusp3 Rat lamivudine multiple interactions ISO Dusp3 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of DUSP3 mRNA more ... CTD PMID:16931933 Dusp3 Rat lipopolysaccharide multiple interactions ISO DUSP3 (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of DUSP3 mRNA CTD PMID:35877022 Dusp3 Rat menadione affects expression ISO DUSP3 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of DUSP3 mRNA CTD PMID:20044591 Dusp3 Rat methidathion decreases expression ISO Dusp3 (Mus musculus) 6480464 methidathion results in decreased expression of DUSP3 mRNA CTD PMID:34813904 Dusp3 Rat methotrexate affects expression ISO Dusp3 (Mus musculus) 6480464 Methotrexate affects the expression of DUSP3 mRNA CTD PMID:18502557 Dusp3 Rat methylmercury chloride increases expression ISO DUSP3 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of DUSP3 mRNA CTD PMID:28001369 Dusp3 Rat N-methyl-4-phenylpyridinium decreases expression ISO Dusp3 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of DUSP3 protein CTD PMID:26558463 Dusp3 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Sorafenib co-treated with Methionine] inhibits the reaction [Diethylnitrosamine results in decreased expression of DUSP3 mRNA] CTD PMID:38367245 Dusp3 Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of DUSP3 mRNA CTD PMID:38367245 Dusp3 Rat nickel atom increases expression ISO DUSP3 (Homo sapiens) 6480464 Nickel results in increased expression of DUSP3 mRNA CTD PMID:24768652 and PMID:25583101 Dusp3 Rat nitrates multiple interactions ISO Dusp3 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of DUSP3 mRNA CTD PMID:35964746 Dusp3 Rat Nutlin-3 increases expression ISO DUSP3 (Homo sapiens) 6480464 nutlin 3 results in increased expression of DUSP3 mRNA CTD PMID:38460933 Dusp3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of DUSP3 mRNA CTD PMID:25729387 Dusp3 Rat ozone multiple interactions ISO Dusp3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of DUSP3 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of DUSP3 mRNA CTD PMID:27106289 and PMID:34911549 Dusp3 Rat paclitaxel decreases expression ISO DUSP3 (Homo sapiens) 6480464 Paclitaxel results in decreased expression of DUSP3 mRNA CTD PMID:15000894 Dusp3 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of DUSP3 mRNA CTD PMID:33387578 Dusp3 Rat parathion increases expression ISO Dusp3 (Mus musculus) 6480464 Parathion results in increased expression of DUSP3 mRNA CTD PMID:34813904 Dusp3 Rat perfluorooctane-1-sulfonic acid decreases expression ISO Dusp3 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of DUSP3 protein CTD PMID:26178269 Dusp3 Rat phenobarbital increases expression ISO Dusp3 (Mus musculus) 6480464 Phenobarbital results in increased expression of DUSP3 mRNA CTD PMID:19482888 Dusp3 Rat phenobarbital multiple interactions ISO Dusp3 (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of DUSP3 mRNA] CTD PMID:19482888 Dusp3 Rat phenylmercury acetate increases expression ISO DUSP3 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of DUSP3 mRNA CTD PMID:26272509 Dusp3 Rat phenylmercury acetate multiple interactions ISO DUSP3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DUSP3 mRNA CTD PMID:27188386 Dusp3 Rat pirinixic acid increases expression ISO Dusp3 (Mus musculus) 6480464 pirinixic acid results in increased expression of DUSP3 mRNA CTD PMID:18301758 Dusp3 Rat propiconazole increases expression ISO Dusp3 (Mus musculus) 6480464 propiconazole results in increased expression of DUSP3 mRNA CTD PMID:21278054 and PMID:22334560 Dusp3 Rat resveratrol decreases expression ISO DUSP3 (Homo sapiens) 6480464 resveratrol results in decreased expression of DUSP3 protein CTD PMID:18089832 Dusp3 Rat resveratrol increases expression ISO Dusp3 (Mus musculus) 6480464 resveratrol results in increased expression of DUSP3 protein CTD PMID:25505154 Dusp3 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of DUSP3 mRNA CTD PMID:19013527 Dusp3 Rat rotenone increases expression ISO DUSP3 (Homo sapiens) 6480464 Rotenone results in increased expression of DUSP3 mRNA CTD PMID:33512557 Dusp3 Rat saquinavir multiple interactions ISO Dusp3 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine co-treated with Saquinavir] results in increased expression of DUSP3 mRNA CTD PMID:16931933 Dusp3 Rat SB 431542 multiple interactions ISO DUSP3 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DUSP3 mRNA CTD PMID:27188386 Dusp3 Rat selenomethionine affects expression ISO DUSP3 (Homo sapiens) 6480464 Selenomethionine affects the expression of DUSP3 mRNA CTD PMID:17222674 Dusp3 Rat silicon dioxide increases expression ISO DUSP3 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of DUSP3 mRNA CTD PMID:25351596 Dusp3 Rat silver atom decreases expression ISO Dusp3 (Mus musculus) 6480464 Silver results in decreased expression of DUSP3 mRNA CTD PMID:27131904 Dusp3 Rat silver(0) decreases expression ISO Dusp3 (Mus musculus) 6480464 Silver results in decreased expression of DUSP3 mRNA CTD PMID:27131904 Dusp3 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of DUSP3 protein CTD PMID:19072884 Dusp3 Rat sodium arsenite increases expression ISO DUSP3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of DUSP3 mRNA CTD PMID:38568856 Dusp3 Rat sorafenib multiple interactions EXP 6480464 [Sorafenib co-treated with Methionine] inhibits the reaction [Diethylnitrosamine results in decreased expression of DUSP3 mRNA] CTD PMID:38367245 Dusp3 Rat sorafenib multiple interactions ISO DUSP3 (Homo sapiens) 6480464 [Methionine co-treated with Sorafenib] results in increased expression of DUSP3 mRNA CTD PMID:38367245 Dusp3 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of DUSP3 mRNA CTD PMID:30047161 Dusp3 Rat sunitinib decreases expression ISO DUSP3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of DUSP3 mRNA CTD PMID:31533062 Dusp3 Rat temozolomide decreases expression ISO DUSP3 (Homo sapiens) 6480464 Temozolomide results in decreased expression of DUSP3 mRNA CTD PMID:31758290 Dusp3 Rat tetrachloromethane increases expression ISO Dusp3 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of DUSP3 mRNA CTD PMID:31919559 Dusp3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of DUSP3 mRNA CTD PMID:34492290 Dusp3 Rat thiram increases expression ISO DUSP3 (Homo sapiens) 6480464 Thiram results in increased expression of DUSP3 mRNA CTD PMID:38568856 Dusp3 Rat titanium dioxide decreases methylation ISO Dusp3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DUSP3 promoter alternative form CTD PMID:35295148 Dusp3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of DUSP3 mRNA CTD PMID:25729387 Dusp3 Rat topotecan affects response to substance ISO DUSP3 (Homo sapiens) 6480464 DUSP3 protein affects the susceptibility to Topotecan CTD PMID:16217747 Dusp3 Rat urethane decreases expression ISO DUSP3 (Homo sapiens) 6480464 Urethane results in decreased expression of DUSP3 mRNA CTD PMID:28818685 Dusp3 Rat valproic acid decreases methylation ISO DUSP3 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of DUSP3 gene CTD PMID:29154799 Dusp3 Rat valproic acid increases expression ISO DUSP3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of DUSP3 mRNA CTD PMID:19101580 more ... Dusp3 Rat valproic acid affects expression ISO DUSP3 (Homo sapiens) 6480464 Valproic Acid affects the expression of DUSP3 mRNA CTD PMID:25979313 Dusp3 Rat valproic acid decreases expression ISO DUSP3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DUSP3 mRNA CTD PMID:29154799 Dusp3 Rat valproic acid affects expression ISO Dusp3 (Mus musculus) 6480464 Valproic Acid affects the expression of DUSP3 mRNA CTD PMID:17963808 Dusp3 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of DUSP3 mRNA CTD PMID:19015723 Dusp3 Rat zidovudine multiple interactions ISO Dusp3 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine co-treated with Indinavir] results in increased expression of DUSP3 mRNA more ... CTD PMID:16931933
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (EXP,ISO) 1-chloro-2,4-dinitrobenzene (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (EXP) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP,ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Brodifacoum (EXP) C60 fullerene (EXP) cadmium dichloride (EXP) captan (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) chrysene (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) cumene (ISO) Cuprizon (EXP) cyclosporin A (ISO) cyproconazole (ISO) DDE (ISO) deguelin (ISO) diazinon (ISO) dibutyl phthalate (EXP,ISO) dorsomorphin (ISO) epoxiconazole (ISO) ethanol (ISO) fenthion (ISO) finasteride (EXP) flutamide (EXP) folpet (ISO) gefitinib (ISO) gentamycin (EXP) indinavir (ISO) ivermectin (ISO) L-methionine (EXP,ISO) lamivudine (ISO) lipopolysaccharide (ISO) menadione (ISO) methidathion (ISO) methotrexate (ISO) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) nitrates (ISO) Nutlin-3 (ISO) oxaliplatin (EXP) ozone (ISO) paclitaxel (ISO) paracetamol (EXP) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (ISO) propiconazole (ISO) resveratrol (ISO) rotenone (EXP,ISO) saquinavir (ISO) SB 431542 (ISO) selenomethionine (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (EXP,ISO) sorafenib (EXP,ISO) sulfadimethoxine (EXP) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP,ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) zidovudine (ISO)
Dusp3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 87,420,213 - 87,434,202 (-) NCBI GRCr8 mRatBN7.2 10 86,920,014 - 86,933,739 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 86,920,014 - 86,933,962 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 91,949,402 - 91,961,231 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 91,425,015 - 91,436,834 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 86,818,327 - 86,830,145 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 89,904,578 - 89,918,296 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 89,904,560 - 89,918,427 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 89,697,004 - 89,710,720 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 91,031,206 - 91,044,858 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 85,639,184 - 85,651,010 (-) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
DUSP3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 43,766,125 - 43,778,977 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 43,766,125 - 43,778,977 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 41,843,493 - 41,856,345 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 39,199,015 - 39,211,872 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 39,199,015 - 39,211,872 NCBI Celera 17 38,551,496 - 38,564,369 (-) NCBI Celera Cytogenetic Map 17 q21.31 NCBI HuRef 17 37,607,587 - 37,620,460 (-) NCBI HuRef CHM1_1 17 42,079,099 - 42,091,978 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 44,618,675 - 44,631,521 (-) NCBI T2T-CHM13v2.0
Dusp3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 101,861,967 - 101,877,839 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 101,861,969 - 101,877,839 (-) Ensembl GRCm39 Ensembl GRCm38 11 101,971,141 - 101,987,013 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 101,971,143 - 101,987,013 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 101,835,473 - 101,846,084 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 101,790,249 - 101,800,860 (-) NCBI MGSCv36 mm8 Celera 11 113,679,435 - 113,690,042 (-) NCBI Celera Cytogenetic Map 11 D NCBI cM Map 11 65.48 NCBI
Dusp3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955451 17,064,739 - 17,069,964 (-) NCBI ChiLan1.0 ChiLan1.0
DUSP3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 21,129,511 - 21,142,425 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 23,093,825 - 23,106,712 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 13,618,860 - 13,631,743 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 13,784,618 - 13,797,045 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 13,784,594 - 13,797,045 (+) Ensembl panpan1.1 panPan2
DUSP3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 19,518,302 - 19,531,000 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 19,518,746 - 19,527,624 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 18,906,433 - 18,920,193 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 20,212,506 - 20,226,067 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 20,213,966 - 20,226,637 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 19,065,068 - 19,078,844 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 19,248,263 - 19,261,805 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 19,393,335 - 19,406,908 (+) NCBI UU_Cfam_GSD_1.0
Dusp3
DUSP3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 19,336,354 - 19,349,734 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 19,336,308 - 19,349,739 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 19,569,958 - 19,583,370 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DUSP3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 62,622,667 - 62,637,129 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 62,622,663 - 62,637,127 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 33,395,825 - 33,410,367 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dusp3
.
Predicted Target Of
Count of predictions: 412 Count of miRNA genes: 238 Interacting mature miRNAs: 282 Transcripts: ENSRNOT00000055194 Prediction methods: Microtar, Miranda Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631555 Bp134 Blood pressure QTL 134 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 80515287 91230079 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 4889948 Bss91 Bone structure and strength QTL 91 4 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 10 82564856 92369470 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 8694173 Bw149 Body weight QTL 149 4.38 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 10 44441699 89441699 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2301967 Cm73 Cardiac mass QTL 73 4.55 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 10 14487011 89062041 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 70188 BpQTLcluster1 Blood pressure QTL cluster 1 4.864 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 42323132 87323132 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 9589030 Epfw9 Epididymal fat weight QTL 9 19.24 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 10 44441699 89441699 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 70198 BpQTLcluster9 Blood pressure QTL cluster 9 2.94 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 42323132 87323132 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 724556 Pur2 Proteinuria QTL 2 5.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 22427500 90627625 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2306792 Ean4 Experimental allergic neuritis QTL 4 4 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 84022321 93995963 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 1358915 Stresp7 Stress response QTL 7 3.52 blood norepinephrine amount (VT:0005663) plasma norepinephrine level (CMO:0001010) 10 78899655 87307728 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 7411614 Foco18 Food consumption QTL 18 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 10 44441699 89441699 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 12880055 Am11 Aortic mass QTL 11 0.004 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 84007272 95933025 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 2301398 Kidm38 Kidney mass QTL 38 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 84007272 95933025 Rat 1600367 Mcs15 Mammary carcinoma susceptibility QTL 15 4.5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 85565469 103884409 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631537 Oia4 Oil induced arthritis QTL 4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 75631887 87055282 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
RH141697
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 86,922,280 - 86,922,486 (+) MAPPER mRatBN7.2 Rnor_6.0 10 89,906,844 - 89,907,049 NCBI Rnor6.0 Rnor_5.0 10 89,699,270 - 89,699,475 UniSTS Rnor5.0 RGSC_v3.4 10 91,033,473 - 91,033,678 UniSTS RGSC3.4 Celera 10 85,641,450 - 85,641,655 UniSTS Cytogenetic Map 10 q32.1 UniSTS
RH128660
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 86,920,059 - 86,920,261 (+) MAPPER mRatBN7.2 Rnor_6.0 10 89,904,624 - 89,904,825 NCBI Rnor6.0 Rnor_5.0 10 89,697,050 - 89,697,251 UniSTS Rnor5.0 RGSC_v3.4 10 91,031,252 - 91,031,453 UniSTS RGSC3.4 Celera 10 85,639,230 - 85,639,431 UniSTS RH 3.4 Map 10 881.5 UniSTS Cytogenetic Map 10 q32.1 UniSTS
BE102766
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 86,931,081 - 86,931,242 (+) MAPPER mRatBN7.2 Rnor_6.0 10 89,915,647 - 89,915,807 NCBI Rnor6.0 Rnor_5.0 10 89,708,073 - 89,708,233 UniSTS Rnor5.0 RGSC_v3.4 10 91,042,276 - 91,042,436 UniSTS RGSC3.4 Celera 10 85,650,258 - 85,650,418 UniSTS RH 3.4 Map 10 885.3 UniSTS Cytogenetic Map 10 q32.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000055194 ⟹ ENSRNOP00000052065
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 86,920,014 - 86,933,962 (-) Ensembl Rnor_6.0 Ensembl 10 89,904,584 - 89,916,400 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000084217 ⟹ ENSRNOP00000072656
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 86,927,716 - 86,931,873 (-) Ensembl Rnor_6.0 Ensembl 10 89,904,560 - 89,918,427 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110203 ⟹ ENSRNOP00000091785
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 86,920,024 - 86,933,962 (-) Ensembl
RefSeq Acc Id:
NM_001173376 ⟹ NP_001166847
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 87,420,213 - 87,432,035 (-) NCBI mRatBN7.2 10 86,920,014 - 86,931,835 (-) NCBI Rnor_6.0 10 89,904,578 - 89,916,400 (-) NCBI Rnor_5.0 10 89,697,004 - 89,710,720 (-) NCBI Celera 10 85,639,184 - 85,651,010 (-) NCBI
Sequence:
CCGGCATGCAGGGCCCCGCCGCCGCCATGTCCGGCTCTTTTGAGCTCTCGGTGCAAGATCTCAACGACCTGCTCTCGGACGGCAGCGGCTGCTATAGCCTCCCGAGCCAGCCCTGCAACGAGGTCATC
hide sequence
RefSeq Acc Id:
XM_006247402 ⟹ XP_006247464
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 87,420,216 - 87,434,202 (-) NCBI mRatBN7.2 10 86,920,014 - 86,933,739 (-) NCBI Rnor_6.0 10 89,904,578 - 89,918,296 (-) NCBI Rnor_5.0 10 89,697,004 - 89,710,720 (-) NCBI
Sequence:
GAGCATGCCTGGCTATCTCTGGGCACCTCCTAAAAGTTTTCATTTTAAGTCAAGGTAAAATTTA
hide sequence
RefSeq Acc Id:
XM_039086639 ⟹ XP_038942567
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 87,420,216 - 87,431,720 (-) NCBI mRatBN7.2 10 86,920,014 - 86,931,370 (-) NCBI
RefSeq Acc Id:
NP_001166847 ⟸ NM_001173376
- UniProtKB:
B5DFF7 (UniProtKB/TrEMBL)
- Sequence:
MQGPAAAMSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVIPRVYVGNASVAQDITQLQKLGITHVLNAAEGRSFMHVNTSASFYKDTGITYMGIKANDTQEFNLSAYFERAADFIDQALAHKNGRVL
hide sequence
RefSeq Acc Id:
XP_006247464 ⟸ XM_006247402
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AF61 (UniProtKB/TrEMBL), A6HJF7 (UniProtKB/TrEMBL), G3V9L3 (UniProtKB/TrEMBL)
- Sequence:
MAMGCGTTQCLYALCYDDPIKGPAAAMSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVIPRVY
hide sequence
Ensembl Acc Id:
ENSRNOP00000052065 ⟸ ENSRNOT00000055194
Ensembl Acc Id:
ENSRNOP00000072656 ⟸ ENSRNOT00000084217
RefSeq Acc Id:
XP_038942567 ⟸ XM_039086639
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000091785 ⟸ ENSRNOT00000110203
RGD ID: 13697770 Promoter ID: EPDNEW_R8294 Type: multiple initiation site Name: Dusp3_1 Description: dual specificity phosphatase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 89,916,416 - 89,916,476 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2014-07-24
Dusp3
dual specificity phosphatase 3
LOC100365414
dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related)-like
Data merged from RGD:2319066
737654 APPROVED
2010-05-05
LOC100365414
dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related)-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2008-09-24
Dusp3
dual specificity phosphatase 3
Dusp3
dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-28
Dusp3
dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related)
RGD1560049_predicted
similar to Dual specificity protein phosphatase 3 (T-DSP11) (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1560049_predicted
similar to Dual specificity protein phosphatase 3 (T-DSP11) (predicted)
LOC498003
similar to Dual specificity protein phosphatase 3 (T-DSP11)
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC498003
similar to Dual specificity protein phosphatase 3 (T-DSP11)
Symbol and Name status set to provisional
70820 PROVISIONAL
