Symbol:
Cdyl
Name:
chromodomain Y-like
RGD ID:
1549745
Description:
Predicted to enable several functions, including crotonyl-CoA hydratase activity; methylated histone binding activity; and transcription corepressor activity. Predicted to be involved in negative regulation of peptidyl-lysine crotonylation; random inactivation of X chromosome; and spermatid development. Predicted to be located in chromosome; cytoplasm; and nuclear speck. Predicted to be active in nucleus. Orthologous to human CDYL (chromodomain Y like); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CDY-like; chromodomain protein, Y chromosome-like; chromodomain protein, Y-like; chromodomain Y-like protein; crotonyl-CoA hydratase; LOC361237; putative tubulin acetyltransferase Cdyl; similar to testis-specific chromodomain Y-like protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CDYL (chromodomain Y like) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cdyl (chromodomain protein, Y chromosome-like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cdyl (chromodomain Y like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CDYL (chromodomain Y like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CDYL (chromodomain Y like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cdyl (chromodomain Y like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CDYL (chromodomain Y like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CDYL (chromodomain Y like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cdyl (chromodomain Y like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CDY2A (chromodomain Y-linked 2A) HGNC
Panther, Treefam
Homo sapiens (human):
CDY1 (chromodomain Y-linked 1) HGNC
Panther, Treefam
Homo sapiens (human):
CDY1B (chromodomain Y-linked 1B) HGNC
Treefam
Homo sapiens (human):
CDY2B (chromodomain Y-linked 2B) HGNC
Treefam
Homo sapiens (human):
SEPTIN11 (septin 11) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Cdyl (chromodomain protein, Y chromosome-like)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CDYL (chromodomain Y like)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cdyl (chromodomain protein, Y-like)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
DCI1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ECI1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
B0272.4
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Drosophila melanogaster (fruit fly):
Dci
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):
cdyl
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 29,188,697 - 29,409,805 (-) NCBI GRCr8 mRatBN7.2 17 28,982,009 - 29,204,345 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 28,982,037 - 29,204,313 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 28,842,955 - 29,058,523 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 30,446,503 - 30,662,290 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 28,818,438 - 29,033,458 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 29,672,925 - 29,895,416 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 29,674,164 - 29,895,386 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 31,568,495 - 31,795,097 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 35,290,255 - 35,517,646 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 17 28,583,965 - 28,798,437 (-) NCBI Celera Cytogenetic Map 17 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cdyl Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of CDYL mRNA] CTD PMID:31150632 Cdyl Rat 1,2-dichloroethane decreases expression ISO Cdyl (Mus musculus) 6480464 ethylene dichloride results in decreased expression of CDYL mRNA CTD PMID:28960355 Cdyl Rat 1,2-dimethylhydrazine decreases expression ISO Cdyl (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CDYL mRNA CTD PMID:22206623 Cdyl Rat 17alpha-ethynylestradiol affects expression ISO Cdyl (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of CDYL mRNA CTD PMID:17555576 Cdyl Rat 17alpha-ethynylestradiol multiple interactions ISO Cdyl (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CDYL mRNA CTD PMID:17942748 Cdyl Rat 17alpha-ethynylestradiol increases expression ISO Cdyl (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of CDYL mRNA CTD PMID:17942748 Cdyl Rat 17beta-estradiol decreases expression ISO Cdyl (Mus musculus) 6480464 Estradiol results in decreased expression of CDYL mRNA CTD PMID:39298647 Cdyl Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO CDYL (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Cdyl Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cdyl (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CDYL mRNA CTD PMID:17942748 Cdyl Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CDYL mRNA CTD PMID:32109520 Cdyl Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cdyl (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CDYL mRNA CTD PMID:21570461 Cdyl Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Cdyl (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CDYL mRNA CTD PMID:19770486 Cdyl Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Cdyl (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CDYL mRNA CTD PMID:19465110 Cdyl Rat 2,4,6-tribromophenol decreases expression ISO CDYL (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Cdyl Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO CDYL (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of CDYL protein CTD PMID:31675489 Cdyl Rat aflatoxin B1 increases expression ISO CDYL (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of CDYL mRNA CTD PMID:27153756 Cdyl Rat aflatoxin B1 decreases methylation ISO CDYL (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of CDYL gene CTD PMID:27153756 Cdyl Rat antirheumatic drug increases expression ISO CDYL (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of CDYL mRNA CTD PMID:24449571 Cdyl Rat aristolochic acid A decreases expression ISO CDYL (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of CDYL mRNA CTD PMID:33212167 Cdyl Rat arsane affects methylation ISO CDYL (Homo sapiens) 6480464 Arsenic affects the methylation of CDYL gene CTD PMID:25304211 Cdyl Rat arsane multiple interactions ISO CDYL (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CDYL mRNA CTD PMID:39836092 Cdyl Rat arsenic atom affects methylation ISO CDYL (Homo sapiens) 6480464 Arsenic affects the methylation of CDYL gene CTD PMID:25304211 Cdyl Rat arsenic atom multiple interactions ISO CDYL (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CDYL mRNA CTD PMID:39836092 Cdyl Rat benzo[a]pyrene increases mutagenesis ISO CDYL (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of CDYL gene CTD PMID:25435355 Cdyl Rat benzo[a]pyrene decreases methylation ISO CDYL (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CDYL 5' UTR and Benzo(a)pyrene results in decreased methylation of CDYL promoter CTD PMID:27901495 Cdyl Rat benzo[a]pyrene decreases expression ISO CDYL (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CDYL mRNA CTD PMID:20064835 Cdyl Rat benzo[a]pyrene diol epoxide I decreases expression ISO CDYL (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20382639 Cdyl Rat bis(2-chloroethyl) sulfide decreases expression ISO Cdyl (Mus musculus) 6480464 Mustard Gas results in decreased expression of CDYL mRNA CTD PMID:26392148 Cdyl Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CDYL mRNA CTD PMID:25181051 and PMID:34947998 Cdyl Rat bisphenol A decreases expression ISO CDYL (Homo sapiens) 6480464 bisphenol A results in decreased expression of CDYL protein CTD PMID:31675489 Cdyl Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CDYL gene CTD PMID:28505145 Cdyl Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of CDYL mRNA CTD PMID:33453195 Cdyl Rat cadmium dichloride increases expression ISO CDYL (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of CDYL mRNA CTD PMID:26472689 Cdyl Rat caffeine affects phosphorylation ISO CDYL (Homo sapiens) 6480464 Caffeine affects the phosphorylation of CDYL protein CTD PMID:35688186 Cdyl Rat calcitriol increases expression ISO CDYL (Homo sapiens) 6480464 Calcitriol results in increased expression of CDYL mRNA CTD PMID:16002434 Cdyl Rat cannabidiol increases expression ISO CDYL (Homo sapiens) 6480464 Cannabidiol results in increased expression of CDYL mRNA CTD PMID:27918106 Cdyl Rat CGP 52608 multiple interactions ISO CDYL (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CDYL gene] CTD PMID:28238834 Cdyl Rat chlorpyrifos decreases expression ISO Cdyl (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of CDYL mRNA CTD PMID:32715474 Cdyl Rat choline multiple interactions ISO Cdyl (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CDYL gene CTD PMID:20938992 Cdyl Rat copper(II) sulfate increases expression ISO CDYL (Homo sapiens) 6480464 Copper Sulfate results in increased expression of CDYL mRNA CTD PMID:19549813 Cdyl Rat coumarin increases phosphorylation ISO CDYL (Homo sapiens) 6480464 coumarin results in increased phosphorylation of CDYL protein CTD PMID:35688186 Cdyl Rat coumestrol decreases expression ISO CDYL (Homo sapiens) 6480464 Coumestrol results in decreased expression of CDYL mRNA CTD PMID:19167446 Cdyl Rat crocidolite asbestos increases expression ISO CDYL (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of CDYL mRNA CTD PMID:25351596 Cdyl Rat cyclosporin A increases expression ISO CDYL (Homo sapiens) 6480464 Cyclosporine results in increased expression of CDYL mRNA CTD PMID:20106945 Cdyl Rat cyclosporin A increases expression ISO Cdyl (Mus musculus) 6480464 Cyclosporine results in increased expression of CDYL mRNA CTD PMID:19770486 Cdyl Rat decabromodiphenyl ether increases expression ISO CDYL (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of CDYL protein CTD PMID:31675489 Cdyl Rat dorsomorphin multiple interactions ISO CDYL (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CDYL mRNA CTD PMID:27188386 Cdyl Rat entinostat increases expression ISO CDYL (Homo sapiens) 6480464 entinostat results in increased expression of CDYL mRNA CTD PMID:26272509 Cdyl Rat entinostat multiple interactions ISO CDYL (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CDYL mRNA CTD PMID:27188386 Cdyl Rat folic acid multiple interactions ISO Cdyl (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CDYL gene CTD PMID:20938992 Cdyl Rat formaldehyde decreases expression ISO CDYL (Homo sapiens) 6480464 Formaldehyde results in decreased expression of CDYL mRNA CTD PMID:20655997 Cdyl Rat FR900359 increases phosphorylation ISO CDYL (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of CDYL protein CTD PMID:37730182 Cdyl Rat furan increases expression EXP 6480464 furan results in increased expression of CDYL mRNA CTD PMID:27387713 Cdyl Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of CDYL gene CTD PMID:31011160 Cdyl Rat isoprenaline increases expression ISO Cdyl (Mus musculus) 6480464 Isoproterenol results in increased expression of CDYL mRNA CTD PMID:20003209 Cdyl Rat L-methionine multiple interactions ISO Cdyl (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of CDYL gene CTD PMID:20938992 Cdyl Rat lead nitrate decreases expression EXP 6480464 lead nitrate results in decreased expression of CDYL mRNA CTD PMID:21628963 Cdyl Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of CDYL gene CTD PMID:35440735 Cdyl Rat methylmercury chloride increases expression ISO CDYL (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of CDYL mRNA CTD PMID:28001369 Cdyl Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of CDYL gene CTD PMID:33148267 Cdyl Rat paracetamol increases expression ISO CDYL (Homo sapiens) 6480464 Acetaminophen results in increased expression of CDYL mRNA CTD PMID:29067470 Cdyl Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CDYL mRNA CTD PMID:33387578 Cdyl Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of CDYL gene CTD PMID:33148267 Cdyl Rat pirinixic acid increases expression ISO Cdyl (Mus musculus) 6480464 pirinixic acid results in increased expression of CDYL mRNA CTD PMID:17426115 and PMID:18445702 Cdyl Rat SB 431542 multiple interactions ISO CDYL (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CDYL mRNA CTD PMID:27188386 Cdyl Rat sodium arsenite decreases expression ISO CDYL (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CDYL mRNA CTD PMID:32844245 Cdyl Rat sodium arsenite multiple interactions ISO CDYL (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CDYL mRNA CTD PMID:39836092 Cdyl Rat sunitinib increases expression ISO CDYL (Homo sapiens) 6480464 Sunitinib results in increased expression of CDYL mRNA CTD PMID:31533062 Cdyl Rat tamoxifen affects expression ISO Cdyl (Mus musculus) 6480464 Tamoxifen affects the expression of CDYL mRNA CTD PMID:17555576 Cdyl Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of CDYL mRNA] CTD PMID:31150632 Cdyl Rat tetrachloromethane increases expression ISO Cdyl (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CDYL mRNA CTD PMID:31919559 Cdyl Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of CDYL mRNA CTD PMID:31150632 Cdyl Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CDYL mRNA CTD PMID:34492290 Cdyl Rat titanium dioxide decreases methylation ISO Cdyl (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CDYL promoter CTD PMID:35295148 Cdyl Rat tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of CDYL mRNA CTD PMID:21683754 Cdyl Rat triphenyl phosphate affects expression ISO CDYL (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CDYL mRNA CTD PMID:37042841 Cdyl Rat urethane increases expression ISO CDYL (Homo sapiens) 6480464 Urethane results in increased expression of CDYL mRNA CTD PMID:28818685 Cdyl Rat valproic acid affects expression ISO CDYL (Homo sapiens) 6480464 Valproic Acid affects the expression of CDYL mRNA CTD PMID:25979313 Cdyl Rat valproic acid increases expression ISO CDYL (Homo sapiens) 6480464 Valproic Acid results in increased expression of CDYL mRNA CTD PMID:29154799 Cdyl Rat zinc atom multiple interactions ISO CDYL (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of CDYL mRNA CTD PMID:18593933 Cdyl Rat zinc(0) multiple interactions ISO CDYL (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of CDYL mRNA CTD PMID:18593933
(+)-schisandrin B (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) aflatoxin B1 (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calcitriol (ISO) cannabidiol (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) copper(II) sulfate (ISO) coumarin (ISO) coumestrol (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dorsomorphin (ISO) entinostat (ISO) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) furan (EXP) glyphosate (EXP) isoprenaline (ISO) L-methionine (ISO) lead nitrate (EXP) methoxychlor (EXP) methylmercury chloride (ISO) N,N-diethyl-m-toluamide (EXP) paracetamol (EXP,ISO) permethrin (EXP) pirinixic acid (ISO) SB 431542 (ISO) sodium arsenite (ISO) sunitinib (ISO) tamoxifen (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) titanium dioxide (ISO) tributylstannane (EXP) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Cdyl Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 29,188,697 - 29,409,805 (-) NCBI GRCr8 mRatBN7.2 17 28,982,009 - 29,204,345 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 28,982,037 - 29,204,313 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 28,842,955 - 29,058,523 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 30,446,503 - 30,662,290 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 28,818,438 - 29,033,458 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 29,672,925 - 29,895,416 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 29,674,164 - 29,895,386 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 31,568,495 - 31,795,097 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 35,290,255 - 35,517,646 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 17 28,583,965 - 28,798,437 (-) NCBI Celera Cytogenetic Map 17 p12 NCBI
CDYL Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 4,706,138 - 4,955,544 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 4,706,159 - 4,955,551 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 4,706,372 - 4,955,778 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 4,651,392 - 4,900,777 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 6 5,934,977 - 6,184,408 (+) NCBI Celera Cytogenetic Map 6 p25.1 NCBI HuRef 6 4,582,442 - 4,832,036 (+) NCBI HuRef CHM1_1 6 4,708,950 - 4,958,157 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 4,575,080 - 4,824,553 (+) NCBI T2T-CHM13v2.0
Cdyl Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 35,843,801 - 36,058,047 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 35,843,816 - 36,058,046 (+) Ensembl GRCm39 Ensembl GRCm38 13 35,659,818 - 35,874,064 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 35,659,833 - 35,874,063 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 35,751,731 - 35,965,933 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 35,667,345 - 35,881,089 (+) NCBI MGSCv36 mm8 Celera 13 36,773,088 - 36,987,151 (+) NCBI Celera Cytogenetic Map 13 A3.3 NCBI cM Map 13 14.39 NCBI
Cdyl Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955465 8,568,121 - 8,780,569 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955465 8,570,197 - 8,780,551 (-) NCBI ChiLan1.0 ChiLan1.0
CDYL Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 19,400,677 - 19,584,327 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 15,404,782 - 15,588,429 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 4,607,088 - 4,790,742 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 4,794,549 - 4,976,777 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 4,737,306 - 4,976,777 (+) Ensembl panpan1.1 panPan2
CDYL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 4,844,757 - 5,074,967 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 4,844,779 - 5,073,670 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 35 4,853,975 - 5,083,877 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 35 5,118,280 - 5,146,543 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 35 4,964,027 - 5,145,246 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 35 4,781,582 - 5,011,396 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 4,803,787 - 5,036,379 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 6,137,854 - 6,368,214 (+) NCBI UU_Cfam_GSD_1.0
Cdyl Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 19,256,632 - 19,476,186 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936534 7,525,612 - 7,594,813 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936534 7,525,618 - 7,601,184 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CDYL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 2,846,090 - 2,966,240 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 2,845,903 - 2,967,537 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 3,054,156 - 3,070,657 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CDYL Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 67,222,212 - 67,396,735 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 67,222,210 - 67,396,630 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 4,730,625 - 4,904,706 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cdyl
.
Predicted Target Of
Count of predictions: 119 Count of miRNA genes: 99 Interacting mature miRNAs: 105 Transcripts: ENSRNOT00000048757 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 2300002 Iddm36 Insulin dependent diabetes mellitus QTL 36 1.98 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 9991286 40540197 Rat 1354640 Scl32 Serum cholesterol level QTL 32 5.4 blood HDL cholesterol amount (VT:0000184) blood high density lipoprotein cholesterol level (CMO:0000052) 17 15781592 60781592 Rat 152023626 Bp403 Blood pressure QTL 403 3.86 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 1300123 Bp194 Blood pressure QTL 194 2.82 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 2115149 34551001 Rat 9590107 Sffal7 Serum free fatty acids level QTL 7 4.81 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 17 28409147 73409147 Rat 2302377 Scl61 Serum cholesterol level QTL 61 4.36 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 17 27389946 53481766 Rat 70157 Niddm32 Non-insulin dependent diabetes mellitus QTL 32 4.34 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 22454924 50909196 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 1354628 Stl13 Serum triglyceride level QTL 13 3.8 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 21293039 60781592 Rat 1581512 Cm55 Cardiac mass QTL 55 2.8 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 27027949 56836890 Rat 10401807 Kidm52 Kidney mass QTL 52 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 1 31701463 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 61394 Bp8 Blood pressure QTL 8 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 23080567 59555013 Rat 1559055 Bp278 Blood pressure QTL 278 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 68653184 Rat 152025238 Slep14 Serum leptin concentration QTL 14 4.62 blood leptin amount (VT:0005667) 17 24184890 79524188 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 1354613 Kidm14 Kidney mass QTL 14 6.2 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 17 4299130 35837242 Rat 1331765 Hrtrt15 Heart rate QTL 15 4.094 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 17 15330613 55836425 Rat 8552928 Pigfal9 Plasma insulin-like growth factor 1 level QTL 9 9 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 17 28409147 73409147 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 12903980 Cm120 Cardiac mass QTL 120 0.002 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 17 23653184 68653184 Rat 70184 BpQTLcluster14 Blood pressure QTL cluster 14 3.38 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 1 31990913 Rat 12903981 Am17 Aortic mass QTL 17 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 17 23653184 68653184 Rat 4889891 Eae32 Experimental allergic encephalomyelitis QTL 32 4.8 0.0002 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 17 27027949 36146731 Rat 4889955 Bss93 Bone structure and strength QTL 93 4.4 tibia size trait (VT:0100001) tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727) 17 27027949 60463643 Rat 2303561 Bw91 Body weight QTL 91 2 body mass (VT:0001259) body weight (CMO:0000012) 17 8868462 53868462 Rat 12903982 Kidm70 Kidney mass QTL 70 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 23653184 70974005 Rat 631207 Niddm41 Non-insulin dependent diabetes mellitus QTL 41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 17 1 37830672 Rat 12903978 Cm118 Cardiac mass QTL 118 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 17 23653184 68653184 Rat 12903979 Cm119 Cardiac mass QTL 119 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 17 23653184 68653184 Rat 1354619 Bp242 Blood pressure QTL 242 6.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 24599340 69599340 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 152023740 Bp406 Blood pressure QTL 406 6.06 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 7488966 Bp370 Blood pressure QTL 370 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 23653184 57246843 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 152023737 Bp405 Blood pressure QTL 405 5.06 arterial blood pressure trait (VT:2000000) 23930421 79524188 Rat 1354659 Scl68 Serum cholesterol level QTL 68 3.9 blood VLDL cholesterol amount (VT:0005144) blood very low density lipoprotein cholesterol level (CMO:0000648) 17 15781592 60781592 Rat 152023736 Bp404 Blood pressure QTL 404 3.78 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat
D17Rat67
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 17 29,292,435 - 29,292,585 (+) Marker Load Pipeline mRatBN7.2 17 29,086,993 - 29,087,143 (+) MAPPER mRatBN7.2 Rnor_6.0 17 29,777,902 - 29,778,051 NCBI Rnor6.0 Rnor_5.0 17 31,673,388 - 31,673,537 UniSTS Rnor5.0 RGSC_v3.4 17 35,394,111 - 35,394,474 RGD RGSC3.4 RGSC_v3.4 17 35,394,196 - 35,394,345 UniSTS RGSC3.4 RGSC_v3.1 17 35,397,037 - 35,397,186 RGD Celera 17 28,687,706 - 28,687,855 UniSTS RH 3.4 Map 17 354.4 UniSTS RH 3.4 Map 17 354.4 RGD RH 2.0 Map 17 247.7 RGD SHRSP x BN Map 17 22.95 RGD Cytogenetic Map 17 p12 UniSTS
D17Got39
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 29,146,299 - 29,146,451 (+) MAPPER mRatBN7.2 Rnor_6.0 17 29,837,205 - 29,837,356 NCBI Rnor6.0 Rnor_5.0 17 31,731,535 - 31,731,686 UniSTS Rnor5.0 RGSC_v3.4 17 35,456,060 - 35,456,212 RGD RGSC3.4 RGSC_v3.4 17 35,456,061 - 35,456,212 UniSTS RGSC3.4 RGSC_v3.1 17 35,458,901 - 35,459,053 RGD Celera 17 28,747,100 - 28,747,251 UniSTS RH 3.4 Map 17 327.6 UniSTS RH 3.4 Map 17 327.6 RGD RH 2.0 Map 17 253.3 RGD Cytogenetic Map 17 p12 UniSTS
AU048359
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 29,125,175 - 29,125,458 (+) MAPPER mRatBN7.2 Rnor_6.0 17 29,816,084 - 29,816,366 NCBI Rnor6.0 Rnor_5.0 17 31,711,570 - 31,711,852 UniSTS Rnor5.0 RGSC_v3.4 17 35,433,828 - 35,434,110 UniSTS RGSC3.4 Celera 17 28,725,954 - 28,726,236 UniSTS Cytogenetic Map 17 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000048757 ⟹ ENSRNOP00000048651
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 28,983,248 - 29,204,313 (-) Ensembl Rnor_6.0 Ensembl 17 29,674,164 - 29,895,386 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096321 ⟹ ENSRNOP00000087116
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 28,983,248 - 29,180,591 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100703 ⟹ ENSRNOP00000095115
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 28,982,037 - 29,118,380 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000102044 ⟹ ENSRNOP00000078746
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 28,982,037 - 29,118,797 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106207 ⟹ ENSRNOP00000078650
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 28,983,248 - 29,118,797 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119808 ⟹ ENSRNOP00000080331
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 28,983,248 - 29,070,498 (-) Ensembl
RefSeq Acc Id:
NM_001014145 ⟹ NP_001014167
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 29,188,698 - 29,409,757 (-) NCBI mRatBN7.2 17 28,983,248 - 29,204,313 (-) NCBI Rnor_6.0 17 29,674,164 - 29,895,386 (-) NCBI Rnor_5.0 17 31,568,495 - 31,795,097 (-) NCBI RGSC_v3.4 17 35,290,255 - 35,517,646 (-) RGD Celera 17 28,583,965 - 28,798,437 (-) RGD
Sequence:
TGGAGGGTATCTTGCTTTGAGGTGGTTTAGCGTCCCACTTGTTCCTTGAGGACATCTGTTACTACCTAAGAGCACTCACCTGAAGGAGATGCTCAAAGGTCCAGAAGGGACACGTCTCGGGTGACAAA
hide sequence
RefSeq Acc Id:
XM_006253839 ⟹ XP_006253901
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 29,188,697 - 29,324,097 (-) NCBI mRatBN7.2 17 28,982,009 - 29,118,730 (-) NCBI Rnor_6.0 17 29,672,925 - 29,809,655 (-) NCBI Rnor_5.0 17 31,568,495 - 31,795,097 (-) NCBI
Sequence:
CCCGGAACGGAGTCCGTGCTCCCCTTGGCCGCCCCGCCCCGCCGCCTCCCACCCCTCCCGCGAG
hide sequence
RefSeq Acc Id:
XM_006253840 ⟹ XP_006253902
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 29,188,697 - 29,252,510 (-) NCBI mRatBN7.2 17 28,982,009 - 29,047,061 (-) NCBI Rnor_6.0 17 29,672,925 - 29,749,358 (-) NCBI Rnor_5.0 17 31,568,495 - 31,795,097 (-) NCBI
Sequence:
CACACACACACACACACACACTCCACTAAATCACTAAATTCTATCATGGACTGAATTTGAGTTTGTCTCTGTGCTGTTGCACAGAAAGTGTCCTACAGAGCTGGGCCTGCTGGTGTATACTCAGTACT
hide sequence
RefSeq Acc Id:
XM_017600600 ⟹ XP_017456089
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 29,188,697 - 29,409,805 (-) NCBI mRatBN7.2 17 28,982,009 - 29,204,343 (-) NCBI Rnor_6.0 17 29,672,925 - 29,895,416 (-) NCBI
Sequence:
AGCCAGGGCAGAGACAGTTTCCAGGCATGATGGAGGGTATCTTGCTTTGAGGTGGTTTAGCGTC
hide sequence
RefSeq Acc Id:
XM_017600601 ⟹ XP_017456090
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 29,188,697 - 29,324,097 (-) NCBI mRatBN7.2 17 28,982,009 - 29,118,731 (-) NCBI Rnor_6.0 17 29,672,925 - 29,809,655 (-) NCBI
Sequence:
CCCGGAACGGAGTCCGTGCTCCCCTTGGCCGCCCCGCCCCGCCGCCTCCCACCCCTCCCGCGAG
hide sequence
RefSeq Acc Id:
XM_039095879 ⟹ XP_038951807
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 29,188,697 - 29,409,805 (-) NCBI mRatBN7.2 17 28,982,009 - 29,204,343 (-) NCBI
RefSeq Acc Id:
XM_039095880 ⟹ XP_038951808
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 29,188,697 - 29,318,519 (-) NCBI mRatBN7.2 17 28,982,009 - 29,113,046 (-) NCBI
RefSeq Acc Id:
XM_039095881 ⟹ XP_038951809
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 29,188,697 - 29,324,216 (-) NCBI mRatBN7.2 17 28,982,009 - 29,118,723 (-) NCBI
RefSeq Acc Id:
XM_039095882 ⟹ XP_038951810
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 29,188,697 - 29,324,097 (-) NCBI mRatBN7.2 17 28,982,009 - 29,118,728 (-) NCBI
RefSeq Acc Id:
XM_063276580 ⟹ XP_063132650
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 29,188,697 - 29,324,102 (-) NCBI
RefSeq Acc Id:
XM_063276581 ⟹ XP_063132651
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 29,188,697 - 29,409,805 (-) NCBI
RefSeq Acc Id:
XM_063276582 ⟹ XP_063132652
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 29,188,697 - 29,252,510 (-) NCBI
RefSeq Acc Id:
XM_063276583 ⟹ XP_063132653
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 29,189,957 - 29,409,805 (-) NCBI
RefSeq Acc Id:
NP_001014167 ⟸ NM_001014145
- UniProtKB:
Q6AYK9 (UniProtKB/Swiss-Prot), A6J7E0 (UniProtKB/TrEMBL), A0A8I6A2N0 (UniProtKB/TrEMBL)
- Sequence:
MGLGSSQPSTKEAEPCTLQEKEEHPVDDTRQQNNAVPATVSDPDQVSPAVQDAETQVESIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHNERQKEGTLARANRASPSNAR
hide sequence
RefSeq Acc Id:
XP_006253901 ⟸ XM_006253839
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6G6F9 (UniProtKB/TrEMBL)
- Sequence:
MASEELYEVESIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHNERQKEGTLARANRASPSNARKQISRSTHSALSKTNPKALVVGKDHESKTNQLLATSQKFRKNTAPSLA
hide sequence
RefSeq Acc Id:
XP_006253902 ⟸ XM_006253840
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I6G6F9 (UniProtKB/TrEMBL)
- Sequence:
MLPPSSQVESIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHNERQKE
hide sequence
RefSeq Acc Id:
XP_017456089 ⟸ XM_017600600
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QNJ4 (UniProtKB/TrEMBL), A0A8I6A2N0 (UniProtKB/TrEMBL)
- Sequence:
MGLGSSQPSTKEAEPCTLQEKEEHPVDDTRQQNNAVPATVSDPDQVSPAVQDAETQVESIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHNERQKEGTLARANRASPSNAR
hide sequence
RefSeq Acc Id:
XP_017456090 ⟸ XM_017600601
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6G6F9 (UniProtKB/TrEMBL)
- Sequence:
MASEELYEQNNAVPATVSDPDQVSPAVQDAETQVESIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHNERQKEGTLARANRASPSNARKQISRSTHSALSKTNPKALVVGK
hide sequence
Ensembl Acc Id:
ENSRNOP00000048651 ⟸ ENSRNOT00000048757
RefSeq Acc Id:
XP_038951807 ⟸ XM_039095879
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6A2N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038951810 ⟸ XM_039095882
- Peptide Label:
isoform X12
RefSeq Acc Id:
XP_038951809 ⟸ XM_039095881
- Peptide Label:
isoform X9
- UniProtKB:
A0A8I6G6F9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038951808 ⟸ XM_039095880
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6G6F9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000095115 ⟸ ENSRNOT00000100703
Ensembl Acc Id:
ENSRNOP00000087116 ⟸ ENSRNOT00000096321
Ensembl Acc Id:
ENSRNOP00000078746 ⟸ ENSRNOT00000102044
Ensembl Acc Id:
ENSRNOP00000078650 ⟸ ENSRNOT00000106207
Ensembl Acc Id:
ENSRNOP00000080331 ⟸ ENSRNOT00000119808
RefSeq Acc Id:
XP_063132651 ⟸ XM_063276581
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I6A2N0 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063132650 ⟸ XM_063276580
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6G3K3 (UniProtKB/TrEMBL), A0A8I6G6F9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063132652 ⟸ XM_063276582
- Peptide Label:
isoform X10
- UniProtKB:
A0A8I5ZLF2 (UniProtKB/TrEMBL), A0A8I6G6F9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063132653 ⟸ XM_063276583
- Peptide Label:
isoform X11
RGD ID: 13700404 Promoter ID: EPDNEW_R10927 Type: multiple initiation site Name: Cdyl_1 Description: chromodomain Y-like SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 29,895,390 - 29,895,450 EPDNEW
BioCyc Gene G2FUF-9628 BioCyc
Ensembl Genes ENSRNOG00000032215 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript ENSRNOT00000048757 ENTREZGENE
ENSRNOT00000100703 ENTREZGENE
ENSRNOT00000100703.1 UniProtKB/Swiss-Prot
ENSRNOT00000106207 ENTREZGENE
ENSRNOT00000119808 ENTREZGENE
ENSRNOT00000170256 ENTREZGENE
Gene3D-CATH 1.10.12.10 UniProtKB/Swiss-Prot
2-enoyl-CoA Hydratase, Chain A, domain 1 UniProtKB/Swiss-Prot
2.40.50.40 UniProtKB/Swiss-Prot
IMAGE_CLONE IMAGE:7112869 IMAGE-MGC_LOAD
InterPro Chromo-like_dom_sf UniProtKB/Swiss-Prot
Chromo/chromo_shadow_dom UniProtKB/Swiss-Prot
Chromo_domain UniProtKB/Swiss-Prot
Chromodomain_CS UniProtKB/Swiss-Prot
ClpP/crotonase-like_dom_sf UniProtKB/Swiss-Prot
ECH/Chromodomain_protein UniProtKB/Swiss-Prot
Enoyl-CoA_hydra/iso UniProtKB/Swiss-Prot
Enoyl-CoA_hydra_C UniProtKB/Swiss-Prot
KEGG Report rno:361237 UniProtKB/Swiss-Prot
MGC_CLONE MGC:93912 IMAGE-MGC_LOAD
NCBI Gene 361237 ENTREZGENE
PANTHER CHROMODOMAIN Y-LIKE PROTEIN UniProtKB/Swiss-Prot
PTHR43684 UniProtKB/Swiss-Prot
Pfam Chromo UniProtKB/Swiss-Prot
ECH_1 UniProtKB/Swiss-Prot
PhenoGen Cdyl PhenoGen
PROSITE CHROMO_1 UniProtKB/Swiss-Prot
CHROMO_2 UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000032215 RatGTEx
SMART CHROMO UniProtKB/Swiss-Prot
Superfamily-SCOP SSF52096 UniProtKB/Swiss-Prot
SSF54160 UniProtKB/Swiss-Prot
UniProt A0A8I5ZLF2 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6A2N0 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6G3K3 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6G6F9 ENTREZGENE, UniProtKB/TrEMBL
A0A8L2QNJ4 ENTREZGENE, UniProtKB/TrEMBL
A6J7E0 ENTREZGENE, UniProtKB/TrEMBL
CDYL_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-21
Cdyl
chromodomain Y-like
Cdyl
chromodomain protein, Y-like
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-02-04
Cdyl
chromodomain protein, Y-like
Cdyl
chromodomain protein, Y chromosome-like
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-05
Cdyl
chromodomain protein, Y chromosome-like
LOC361237
similar to testis-specific chromodomain Y-like protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-09-15
LOC361237
similar to testis-specific chromodomain Y-like protein
Symbol and Name status set to provisional
70820 PROVISIONAL
