Advanced Search (OLGA)

Gene: Mtfp1 (mitochondrial fission process 1) Rattus norvegicus

Analyze

Symbol:

Mtfp1

Name:

mitochondrial fission process 1

RGD ID:

1359705

Description:

Involved in response to muscle activity. Predicted to be located in mitochondrial inner membrane. Predicted to be active in mitochondrion. Orthologous to human MTFP1 (mitochondrial fission process 1); PARTICIPATES IN mitochondria fission pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC94604; mitochondrial 18 kDa protein; mitochondrial fission process protein 1; mitochondrial protein 18; mitochondrial protein 18 kDa; mitochondrial protein, 18 kDa; Mtp18

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MTFP1 (mitochondrial fission process 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mtfp1 (mitochondrial fission process 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mtfp1 (mitochondrial fission process 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MTFP1 (mitochondrial fission process 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MTFP1 (mitochondrial fission process 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mtfp1 (mitochondrial fission process 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MTFP1 (mitochondrial fission process 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MTFP1 (mitochondrial fission process 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mtfp1 (mitochondrial fission process 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Mtfp1 (mitochondrial fission process 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ADORA1 (adenosine A1 receptor)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MTFP1 (mitochondrial fission process 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mtfp1 (mitochondrial fission process 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mtfp1 (mitochondrial fission process 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mtp-18	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG7772	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mtfp1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	83,192,013 - 83,195,853 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	83,192,021 - 83,195,927 (-)	Ensembl				GRCr8
mRatBN7.2	14	78,968,434 - 78,972,274 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	78,968,442 - 78,972,274 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	83,409,353 - 83,412,908 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	84,649,432 - 84,652,987 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	81,095,006 - 81,098,910 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	84,330,223 - 84,334,063 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	84,330,218 - 84,334,066 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	85,011,888 - 85,015,728 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	84,723,113 - 84,726,953 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	77,879,437 - 77,883,277 (-)	NCBI		Celera
RGSC_v3.1	14	84,742,257 - 84,746,098 (-)	NCBI
Cytogenetic Map	14	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

neuroblastoma (ISO)

Parkinson's disease 6 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

acetamide (EXP)

acrylamide (ISO)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

aspartame (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (ISO)

cantharidin (ISO)

carbon nanotube (ISO)

chloroacetaldehyde (ISO)

chlorpyrifos (EXP)

cidofovir anhydrous (ISO)

cisplatin (ISO)

cocaine (EXP)

coumestrol (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

disodium selenite (ISO)

diuron (ISO)

doxorubicin (ISO)

endosulfan (EXP)

Enterolactone (ISO)

ethanol (ISO)

fenthion (ISO)

folic acid (ISO)

ibuprofen (ISO)

ifosfamide (ISO)

ivermectin (ISO)

monosodium L-glutamate (ISO)

nickel atom (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sulforaphane (ISO)

sunitinib (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thapsigargin (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

tris(2-butoxyethyl) phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (ISO)

mitochondrial fission (ISO)

mitochondrion organization (ISO)

response to muscle activity (IEP)

Cellular Component

mitochondrial inner membrane (ISO)

mitochondrion (ISO)

Molecular Function

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

mitochondria fission pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Integrative genomics reveals hypoxia inducible genes that are associated with a poor prognosis in neuroblastoma patients.	Applebaum MA, etal., Oncotarget. 2016 Nov 22;7(47):76816-76826. doi: 10.18632/oncotarget.12713.
2.	Mitochondria dynamism: of shape, transport and cell migration.	da Silva AF, etal., Cell Mol Life Sci. 2014 Jun;71(12):2313-24. doi: 10.1007/s00018-014-1557-8. Epub 2014 Jan 18.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Parkinson phenotype in aged PINK1-deficient mice is accompanied by progressive mitochondrial dysfunction in absence of neurodegeneration.	Gispert S, etal., PLoS One. 2009 Jun 3;4(6):e5777. doi: 10.1371/journal.pone.0005777.
5.	The regulation of mitochondrial morphology: intricate mechanisms and dynamic machinery.	Palmer CS, etal., Cell Signal. 2011 Oct;23(10):1534-45. doi: 10.1016/j.cellsig.2011.05.021. Epub 2011 Jun 13.
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation
8.	Global Proteome Changes in the Rat Diaphragm Induced by Endurance Exercise Training.	Sollanek KJ, etal., PLoS One. 2017 Jan 30;12(1):e0171007. doi: 10.1371/journal.pone.0171007. eCollection 2017.
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
10.	Knockdown of MTP18, a novel phosphatidylinositol 3-kinase-dependent protein, affects mitochondrial morphology and induces apoptosis.	Tondera D, etal., J Biol Chem 2004 Jul 23;279(30):31544-55. Epub 2004 May 20.

Additional References at PubMed

PMID:15985469	PMID:18614015	PMID:22871113	PMID:30325740	PMID:31015359	PMID:31337818	PMID:34800366

Genomics

Comparative Map Data

Mtfp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	83,192,013 - 83,195,853 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	83,192,021 - 83,195,927 (-)	Ensembl				GRCr8
mRatBN7.2	14	78,968,434 - 78,972,274 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	78,968,442 - 78,972,274 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	83,409,353 - 83,412,908 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	84,649,432 - 84,652,987 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	81,095,006 - 81,098,910 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	84,330,223 - 84,334,063 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	84,330,218 - 84,334,066 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	14	85,011,888 - 85,015,728 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	84,723,113 - 84,726,953 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	77,879,437 - 77,883,277 (-)	NCBI		Celera
RGSC_v3.1	14	84,742,257 - 84,746,098 (-)	NCBI
Cytogenetic Map	14	q21	NCBI

MTFP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	30,425,768 - 30,429,054 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	30,425,623 - 30,429,054 (+)	Ensembl			hg38	GRCh38
GRCh37	22	30,821,756 - 30,825,041 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	29,151,720 - 29,155,041 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	22	14,621,410 - 14,624,732 (+)	NCBI		Celera
Cytogenetic Map	22	q12.2	NCBI
HuRef	22	13,782,814 - 13,786,245 (+)	NCBI		HuRef
CHM1_1	22	30,781,170 - 30,784,601 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	30,889,111 - 30,892,397 (+)	NCBI		T2T-CHM13v2.0

Mtfp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	4,041,481 - 4,045,431 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	4,041,480 - 4,045,445 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	4,091,481 - 4,095,431 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	4,091,480 - 4,095,445 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	3,991,484 - 3,995,434 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	3,991,484 - 3,995,434 (-)	NCBI		MGSCv36	mm8
Celera	11	4,587,412 - 4,591,361 (-)	NCBI		Celera
Cytogenetic Map	11	A1	NCBI
cM Map	11	2.87	NCBI

Mtfp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	4,660,904 - 4,664,323 (+)	Ensembl
ChiLan1.0	NW_004955455	4,660,847 - 4,664,323 (+)	NCBI	ChiLan1.0	ChiLan1.0

MTFP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	40,391,328 - 40,395,775 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	43,090,753 - 43,094,416 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	11,461,119 - 11,464,739 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	29,262,118 - 29,265,700 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	29,262,118 - 29,265,700 (+)	Ensembl			panPan2	panpan1.1

MTFP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	23,565,438 - 23,568,919 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	23,565,567 - 23,568,510 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	23,436,506 - 23,439,989 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	23,949,521 - 23,953,008 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	23,949,654 - 23,952,599 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	23,651,028 - 23,654,510 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	23,913,804 - 23,917,286 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	23,974,230 - 23,977,712 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Mtfp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	116,480,827 - 116,484,389 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936904	245,913 - 253,216 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936904	249,842 - 253,349 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MTFP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	47,392,665 - 47,396,727 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	47,392,578 - 47,396,115 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	50,477,184 - 50,480,628 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MTFP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	13,305,752 - 13,309,158 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	13,305,888 - 13,309,164 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	112,837,410 - 112,840,946 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mtfp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	6,744,321 - 6,751,257 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624747	6,743,221 - 6,749,375 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Mtfp1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	73,079,893 - 73,083,632 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Mtfp1
14 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	132
Count of miRNA genes:	98
Interacting mature miRNAs:	119
Transcripts:	ENSRNOT00000006160
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582236	Gluco22	Glucose level QTL 22	3.3	0.0164	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	96755654	Rat
9590294	Uminl4	Urine mineral level QTL 4	5.66	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	14	59848686	104848686	Rat
2300197	Scl59	Serum cholesterol level QTL 59			blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	77914838	104348525	Rat
70214	Niddm28	Non-insulin dependent diabetes mellitus QTL 28	4.06		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	39009444	84009444	Rat
70153	Bp59	Blood pressure QTL 59	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	14	72970210	87582095	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30674469	85041098	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	33424686	102238540	Rat
1582259	Gluco23	Glucose level QTL 23	3.1	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	74255551	109089856	Rat
1582197	Gluco27	Glucose level QTL 27	3.4	0.0006	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	77640071	96755654	Rat
634328	Hc5	Hypercalciuria QTL 5	2.3		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	14	62398852	107398852	Rat
1582250	Gluco26	Glucose level QTL 26	3.3	0.0009	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	100078267	Rat
2317879	Alcrsp27	Alcohol response QTL 27	3.3	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	14	60854936	105854936	Rat
1641900	Alcrsp11	Alcohol response QTL 11			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	14	74255551	109089856	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	100078267	Rat
1582255	Gluco29	Glucose level QTL 29	3.1	0.0025	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	14	77640071	96755654	Rat
9589034	Epfw11	Epididymal fat weight QTL 11	6	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	14	59848686	104848686	Rat
1582209	Gluco20	Glucose level QTL 20	3.8	0.0005	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	77640071	96755654	Rat
1300136	Rf22	Renal function QTL 22	3.9		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	14	42616258	99224555	Rat
1549834	Scl45	Serum cholesterol level QTL 45	5.8		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	14	65920283	99224555	Rat
738037	Hcas6	Hepatocarcinoma susceptibility QTL 6	2.93		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	14	39411170	87582095	Rat

Markers in Region

RH137653

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	78,968,956 - 78,969,076 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	84,330,746 - 84,330,865	NCBI	Rnor6.0
Rnor_5.0	14	85,012,411 - 85,012,530	UniSTS	Rnor5.0
RGSC_v3.4	14	84,723,636 - 84,723,755	UniSTS	RGSC3.4
Celera	14	77,879,960 - 77,880,079	UniSTS
Cytogenetic Map	14	q21	UniSTS

RH139394

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	78,973,916 - 78,974,059 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	84,335,706 - 84,335,848	NCBI	Rnor6.0
Rnor_5.0	14	85,017,371 - 85,017,513	UniSTS	Rnor5.0
RGSC_v3.4	14	84,728,596 - 84,728,738	UniSTS	RGSC3.4
Celera	14	77,884,920 - 77,885,062	UniSTS
Cytogenetic Map	14	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	66	160	91	90	59	84	59	6	347	183	11	139	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001006960	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083713	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473963	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006160 ⟹ ENSRNOP00000006160

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	83,192,021 - 83,195,853 (-)	Ensembl
mRatBN7.2 Ensembl	14	78,968,442 - 78,972,274 (-)	Ensembl
Rnor_6.0 Ensembl	14	84,330,218 - 84,334,066 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000124067 ⟹ ENSRNOP00000110794

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	83,192,021 - 83,195,927 (-)	Ensembl

RefSeq Acc Id:

NM_001006960 ⟹ NP_001006961

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	83,192,013 - 83,195,853 (-)	NCBI
mRatBN7.2	14	78,968,434 - 78,972,274 (-)	NCBI
Rnor_6.0	14	84,330,223 - 84,334,063 (-)	NCBI
Rnor_5.0	14	85,011,888 - 85,015,728 (-)	NCBI
RGSC_v3.4	14	84,723,113 - 84,726,953 (-)	RGD
Celera	14	77,879,437 - 77,883,277 (-)	RGD

Sequence:

show sequence

GCCGGACCTGTCCTTCAGTCTCGGACTACTGGCGGGTTCTTGCCTAGTGTTAGCCAAGTGCTAG
TGGAGACAAGAGTTGTGGTGAGACTCTAATCTGCAGTGACTCCTACCGTGCCCGGGAAGTCATG
TCGGAGCAGCAGCGGCAGAGCACCGAGCGCGACCTCTACCGGGACACGTGGGTGCGCTACCTGG
GCTACGCCAATGAAGTGGGGGAGGCTTTCCGCTCCCTGGTTCCTAAAGCTGTGGTGTGGTTGAG
CTATGGCGTGTCCAGCTCCTATGTCTTGGCCGATGCCATAGACAAAGGCAAGAAGGCAGGAGAG
GTGCCAAGCCCTGAAGCAGGCCGCAGTACCAGAATGGCCCTGGCTGTGGTAGATACCTTCGTGT
GGCAGTCTCTGGCCTCTGTGGCCATTCCGGGCTTCACCATCAACCGTCTGTGTGCTGCCTCTCT
CTATGTCTTGGGTACTATGACCCGCTGGCCCCTGAATGTCCGCAAATGGACCACCACCACACTT
GGGCTGCTGGCCATCCCTGTCATTGTCCACCCCATTGACAGGTCGGTAGACTTCCTCCTGGACT
CCAGCCTGCGCAAGCTGTACCCGTCAGTGGGGAAGCCCAGCACCCCCTGACCCTGTCCTGTGCC
CTGCCCGGGGTTGACCCACTCACATCAAAGAACATGGCTACGTGGCTCTTTGGGGTCCATGGTG
CTGTCATCTGAACATAGAGATGAAGGCCCTGAGGAGTAGTGGGCAGTGAGTCCCAGGGTTGGAA
CCCAACCTTGTCTGCATTAGTGGCCATGGCTGTGCTGAGTGGGAACGAACACTGGCTAGCCTGT
CTTTTGAAATCTTTTTTTAAAAGTATTTATTTTGTGTGTATAAGTGTTTTACTTGCATGTATGT
ATGTTCACCACCCTTAGAGGTTAAAAGAGGCGATTAGATCTCCCTGAAACTGGAGGTAGGGATG
GTTGTGAGCCACCATGTGGGTGCTGAGAACTGAATCTGGTTCCTCTGCAGGAGCAGCCAGTGCT
CTAACCACTAAAGTACCTCTTAGCCTCTGGGCCTATCTTCTGATGGAAAAGTTATACCCTCCTG
TGGAGGAGAAGGTTATTAAGGCCCAGAGAGGGCAGGGAATACTCCTGAGATCACATGACAAGTG
AGGACCAGGCTTCTAGCTATTCTAAGTCACTTTGTGATGATGTGGCTGAGTAACTTAGGGAAAG
ATACAGAGGTACAGCATTTGGGACACTCAGGGCAGAGTCTCTGGCCAGCCCATCCCTGCTGCAG
GAGCTGCTGGGGCCTGGTCGAGAGGCAGGACAATCACAAACCAAGTGCTAACCTAATAAAACTT
TCAAAAATGGAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001006961	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83713	(Get FASTA)	NCBI Sequence Viewer
	EDM00209	(Get FASTA)	NCBI Sequence Viewer
	EDM00210	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006160
	ENSRNOP00000006160.3
	ENSRNOP00000110794.1

RefSeq Acc Id:	NP_001006961 ⟸ NM_001006960
- UniProtKB:	Q5XIG9 (UniProtKB/TrEMBL), A6IKE5 (UniProtKB/TrEMBL), A6IKE6 (UniProtKB/TrEMBL), F7EL31 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSEQQRQSTERDLYRDTWVRYLGYANEVGEAFRSLVPKAVVWLSYGVSSSYVLADAIDKGKKAG EVPSPEAGRSTRMALAVVDTFVWQSLASVAIPGFTINRLCAASLYVLGTMTRWPLNVRKWTTTT LGLLAIPVIVHPIDRSVDFLLDSSLRKLYPSVGKPSTP hide sequence

Ensembl Acc Id:

ENSRNOP00000006160 ⟸ ENSRNOT00000006160

Ensembl Acc Id:

ENSRNOP00000110794 ⟸ ENSRNOT00000124067

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XIG9-F1-model_v2	AlphaFold	Q5XIG9	1-166	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699438

Promoter ID:

EPDNEW_R9962

Type:

initiation region

Name:

Mtfp1_1

Description:

mitochondrial fission process 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	84,334,018 - 84,334,078	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359705	AgrOrtholog
BioCyc Gene	G2FUF-15197	BioCyc
Ensembl Genes	ENSRNOG00000004640	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006160	ENTREZGENE
	ENSRNOT00000006160.8	UniProtKB/TrEMBL
	ENSRNOT00000124067.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7190675	IMAGE-MGC_LOAD
InterPro	Mitochondrial_18_kDa_protein_	UniProtKB/TrEMBL
KEGG Report	rno:289745	UniProtKB/TrEMBL
MGC_CLONE	MGC:94604	IMAGE-MGC_LOAD
NCBI Gene	289745	ENTREZGENE
PANTHER	MITOCHONDRIAL FISSION PROCESS PROTEIN 1	UniProtKB/TrEMBL
	PTHR11001	UniProtKB/TrEMBL
Pfam	MTP18	UniProtKB/TrEMBL
PhenoGen	Mtfp1	PhenoGen
RatGTEx	ENSRNOG00000004640	RatGTEx
UniProt	A0ABK0M5K9_RAT	UniProtKB/TrEMBL
	A6IKE5	ENTREZGENE, UniProtKB/TrEMBL
	A6IKE6	ENTREZGENE, UniProtKB/TrEMBL
	F7EL31	ENTREZGENE, UniProtKB/TrEMBL
	Q5XIG9	ENTREZGENE
UniProt Secondary	Q5XIG9	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-05-03	Mtfp1	mitochondrial fission process 1	Mtp18	mitochondrial protein 18	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-04-27	Mtp18	mitochondrial protein 18	Mtp18	mitochondrial protein 18 kDa	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Mtp18	mitochondrial protein 18 kDa	MGC94604	mitochondrial protein, 18 kDa	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-29	MGC94604	mitochondrial protein, 18 kDa			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations