Symbol:
Ndufs1
Name:
NADH:ubiquinone oxidoreductase core subunit S1
RGD ID:
1359670
Description:
Predicted to enable electron transfer activity. Predicted to contribute to NADH dehydrogenase (ubiquinone) activity. Predicted to be involved in mitochondrial electron transport, NADH to ubiquinone and mitochondrial respiratory chain complex I assembly. Predicted to be located in mitochondrial inner membrane and mitochondrial intermembrane space. Predicted to be part of respiratory chain complex I. Human ortholog(s) of this gene implicated in inherited metabolic disorder; mitochondrial complex I deficiency; and nuclear type mitochondrial complex I deficiency 5. Orthologous to human NDUFS1 (NADH:ubiquinone oxidoreductase core subunit S1); PARTICIPATES IN Alzheimer's disease pathway; Huntington's disease pathway; oxidative phosphorylation pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC93795; NADH dehydrogenase (ubiquinone) Fe-S protein 1; NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa; NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NDUFS1 (NADH:ubiquinone oxidoreductase core subunit S1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ndufs1 (NADH:ubiquinone oxidoreductase core subunit S1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ndufs1 (NADH:ubiquinone oxidoreductase core subunit S1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NDUFS1 (NADH:ubiquinone oxidoreductase core subunit S1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NDUFS1 (NADH:ubiquinone oxidoreductase core subunit S1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ndufs1 (NADH:ubiquinone oxidoreductase core subunit S1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NDUFS1 (NADH:ubiquinone oxidoreductase core subunit S1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NDUFS1 (NADH:ubiquinone oxidoreductase core subunit S1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ndufs1 (NADH:ubiquinone oxidoreductase core subunit S1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
NDUFS1 (NADH:ubiquinone oxidoreductase core subunit S1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ndufs1 (NADH:ubiquinone oxidoreductase core subunit S1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
nuo-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
ND-75
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
ndufs1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 72,040,286 - 72,073,605 (-) NCBI GRCr8 mRatBN7.2 9 64,546,430 - 64,579,751 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 64,546,225 - 64,579,893 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 73,049,877 - 73,083,200 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 78,170,168 - 78,204,120 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 76,476,771 - 76,510,751 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 69,919,863 - 69,953,182 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 69,919,867 - 69,953,182 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 69,728,932 - 69,762,079 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 61,798,141 - 61,831,964 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 61,945,124 - 61,978,946 (-) NCBI Celera 9 61,964,379 - 61,997,783 (-) NCBI Celera Cytogenetic Map 9 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ndufs1 Rat (+)-epicatechin-3-O-gallate multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] inhibits the reaction [Hydrogen Peroxide results in decreased expression of NDUFS1 mRNA] and BMAL1 protein affects the reaction [[Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] inhibits the reaction [Hydrogen Peroxide results in decreased expression of NDUFS1 mRNA]] CTD PMID:29061316 Ndufs1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NDUFS1 mRNA] CTD PMID:31150632 Ndufs1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] inhibits the reaction [Hydrogen Peroxide results in decreased expression of NDUFS1 mRNA] and BMAL1 protein affects the reaction [[Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] inhibits the reaction [Hydrogen Peroxide results in decreased expression of NDUFS1 mRNA]] CTD PMID:29061316 Ndufs1 Rat (R,R)-tramadol decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Tramadol results in decreased expression of NDUFS1 mRNA CTD PMID:27317026 Ndufs1 Rat 1,2-dimethylhydrazine multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NDUFS1 mRNA CTD PMID:22206623 Ndufs1 Rat 1,2-dimethylhydrazine decreases expression ISO Ndufs1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NDUFS1 mRNA CTD PMID:22206623 Ndufs1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Ndufs1 (Mus musculus) 6480464 NDUFS1 mutant form inhibits the reaction [[EN1 protein co-treated with EN2 protein] inhibits the reaction [1-Methyl-4-phenyl-1 more ... CTD PMID:21892157 Ndufs1 Rat 17alpha-ethynylestradiol multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NDUFS1 mRNA CTD PMID:17942748 Ndufs1 Rat 17beta-estradiol decreases expression ISO Ndufs1 (Mus musculus) 6480464 Estradiol results in decreased expression of NDUFS1 mRNA CTD PMID:39298647 Ndufs1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NDUFS1 mRNA CTD PMID:17942748 Ndufs1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NDUFS1 mRNA CTD PMID:23152189 Ndufs1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of NDUFS1 mRNA] and alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of NDUFS1 mRNA] CTD PMID:23152189 Ndufs1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NDUFS1 mRNA CTD PMID:21215274 Ndufs1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ndufs1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NDUFS1 mRNA CTD PMID:20399798 Ndufs1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:19954255 Ndufs1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of NDUFS1 mRNA CTD PMID:21346803 Ndufs1 Rat 2-hydroxypropanoic acid decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of NDUFS1 mRNA CTD PMID:30851411 Ndufs1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin analog results in decreased expression of NDUFS1 protein CTD PMID:26597043 Ndufs1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of NDUFS1 mRNA CTD PMID:28628672 Ndufs1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of NDUFS1 mRNA CTD PMID:28628672 Ndufs1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NDUFS1 mRNA CTD PMID:36041667 Ndufs1 Rat 4,4'-sulfonyldiphenol increases expression ISO NDUFS1 (Homo sapiens) 6480464 bisphenol S results in increased expression of NDUFS1 protein CTD PMID:34186270 Ndufs1 Rat 4,4'-sulfonyldiphenol increases expression ISO Ndufs1 (Mus musculus) 6480464 bisphenol S results in increased expression of NDUFS1 mRNA CTD PMID:39298647 Ndufs1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Ndufs1 (Mus musculus) 6480464 bisphenol S results in decreased methylation of NDUFS1 exon CTD PMID:33297965 Ndufs1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of NDUFS1 mRNA CTD PMID:30047161 Ndufs1 Rat acrolein multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of NDUFS1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of and results in increased oxidation of NDUFS1 mRNA CTD PMID:32699268 Ndufs1 Rat aflatoxin B1 increases expression ISO Ndufs1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of NDUFS1 mRNA CTD PMID:19770486 Ndufs1 Rat aflatoxin B1 decreases methylation ISO NDUFS1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of NDUFS1 intron CTD PMID:30157460 Ndufs1 Rat alpha-naphthoflavone multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of NDUFS1 mRNA] CTD PMID:23152189 Ndufs1 Rat alpha-pinene multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of NDUFS1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of and results in increased oxidation of NDUFS1 mRNA CTD PMID:32699268 Ndufs1 Rat amiodarone increases expression ISO Ndufs1 (Mus musculus) 6480464 Amiodarone results in increased expression of NDUFS1 mRNA CTD PMID:24489787 Ndufs1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of NDUFS1 mRNA CTD PMID:30047161 Ndufs1 Rat Aroclor 1254 decreases expression ISO Ndufs1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of NDUFS1 mRNA CTD PMID:23650126 Ndufs1 Rat arsenite(3-) multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to NDUFS1 mRNA] CTD PMID:32406909 Ndufs1 Rat arsenous acid increases expression ISO NDUFS1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NDUFS1 mRNA CTD PMID:22521957 Ndufs1 Rat aspartame multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Ndufs1 Rat benzene multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of NDUFS1 mRNA CTD PMID:17905399 Ndufs1 Rat benzo[a]pyrene affects methylation ISO NDUFS1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NDUFS1 intron CTD PMID:30157460 Ndufs1 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of NDUFS1 mRNA CTD PMID:39150890 Ndufs1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Ndufs1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of NDUFS1 mRNA CTD PMID:34319233 Ndufs1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NDUFS1 mRNA CTD PMID:25181051 Ndufs1 Rat bisphenol A increases expression ISO NDUFS1 (Homo sapiens) 6480464 bisphenol A results in increased expression of NDUFS1 protein CTD PMID:37567409 Ndufs1 Rat bisphenol A decreases expression ISO NDUFS1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of NDUFS1 protein CTD PMID:34186270 Ndufs1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of NDUFS1 mRNA CTD PMID:30816183 more ... Ndufs1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NDUFS1 mRNA and [bisphenol A co-treated with tributyltin] results in increased expression of NDUFS1 mRNA CTD PMID:31129395 and PMID:36041667 Ndufs1 Rat bisphenol AF increases expression ISO NDUFS1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of NDUFS1 protein CTD PMID:34186270 Ndufs1 Rat Bisphenol B increases expression ISO NDUFS1 (Homo sapiens) 6480464 bisphenol B results in increased expression of NDUFS1 protein CTD PMID:34186270 Ndufs1 Rat bisphenol F increases expression ISO Ndufs1 (Mus musculus) 6480464 bisphenol F results in increased expression of NDUFS1 mRNA CTD PMID:38685157 Ndufs1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of NDUFS1 mRNA CTD PMID:36041667 Ndufs1 Rat bisphenol F increases expression ISO NDUFS1 (Homo sapiens) 6480464 bisphenol F results in increased expression of NDUFS1 protein CTD PMID:34186270 Ndufs1 Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of NDUFS1 protein CTD PMID:28903499 Ndufs1 Rat Butylbenzyl phthalate multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of NDUFS1 mRNA CTD PMID:39150890 Ndufs1 Rat cadmium atom increases expression ISO Ndufs1 (Mus musculus) 6480464 Cadmium results in increased expression of NDUFS1 mRNA CTD PMID:26187450 Ndufs1 Rat cadmium atom multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NDUFS1 mRNA CTD PMID:35301059 Ndufs1 Rat cadmium dichloride decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of NDUFS1 mRNA CTD PMID:38568856 Ndufs1 Rat cadmium dichloride multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NDUFS1 mRNA CTD PMID:35301059 Ndufs1 Rat calcitriol multiple interactions EXP 6480464 [Calcium co-treated with Calcitriol] affects the expression of NDUFS1 mRNA CTD PMID:15913539 Ndufs1 Rat calcium atom multiple interactions EXP 6480464 [Calcium co-treated with Calcitriol] affects the expression of NDUFS1 mRNA CTD PMID:15913539 Ndufs1 Rat calcium(0) multiple interactions EXP 6480464 [Calcium co-treated with Calcitriol] affects the expression of NDUFS1 mRNA CTD PMID:15913539 Ndufs1 Rat chlorpyrifos decreases expression ISO Ndufs1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of NDUFS1 mRNA CTD PMID:37019170 Ndufs1 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of NDUFS1 mRNA CTD PMID:17602206 Ndufs1 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of NDUFS1 mRNA CTD PMID:22465980 Ndufs1 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of NDUFS1 mRNA CTD PMID:22465980 Ndufs1 Rat copper(II) chloride decreases expression ISO Ndufs1 (Mus musculus) 6480464 cupric chloride results in decreased expression of NDUFS1 protein CTD PMID:29617964 Ndufs1 Rat cyclosporin A decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of NDUFS1 mRNA CTD PMID:25562108 Ndufs1 Rat dexamethasone multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of NDUFS1 mRNA CTD PMID:28628672 Ndufs1 Rat diarsenic trioxide increases expression ISO NDUFS1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of NDUFS1 mRNA CTD PMID:22521957 Ndufs1 Rat dibutyl phthalate decreases expression ISO Ndufs1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of NDUFS1 mRNA CTD PMID:17361019 and PMID:21266533 Ndufs1 Rat dibutyl phthalate multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of NDUFS1 mRNA CTD PMID:39150890 Ndufs1 Rat dicrotophos decreases expression ISO NDUFS1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of NDUFS1 mRNA CTD PMID:28302478 Ndufs1 Rat diethyl phthalate multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of NDUFS1 mRNA CTD PMID:39150890 Ndufs1 Rat dihydroxyacetone increases expression EXP 6480464 Dihydroxyacetone results in increased expression of NDUFS1 protein CTD PMID:38582340 Ndufs1 Rat diisobutyl phthalate multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of NDUFS1 mRNA CTD PMID:39150890 Ndufs1 Rat diisononyl phthalate multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of NDUFS1 mRNA CTD PMID:39150890 Ndufs1 Rat dioxygen multiple interactions EXP 6480464 [Blood Glucose deficiency co-treated with Oxygen deficiency] results in decreased expression of NDUFS1 mRNA CTD PMID:27693381 Ndufs1 Rat dopamine multiple interactions ISO Ndufs1 (Mus musculus) 6480464 NDUFS1 mutant form inhibits the reaction [[EN1 protein co-treated with EN2 protein] inhibits the reaction [1-Methyl-4-phenyl-1 more ... CTD PMID:21892157 Ndufs1 Rat doxorubicin decreases expression ISO Ndufs1 (Mus musculus) 6480464 Doxorubicin results in decreased expression of NDUFS1 mRNA CTD PMID:26873546 Ndufs1 Rat edaravone multiple interactions EXP 6480464 Edaravone inhibits the reaction [Rotenone results in decreased expression of NDUFS1 mRNA] CTD PMID:27108097 Ndufs1 Rat ethanol affects splicing ISO Ndufs1 (Mus musculus) 6480464 Ethanol affects the splicing of NDUFS1 mRNA CTD PMID:30319688 Ndufs1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of NDUFS1 mRNA CTD PMID:24136188 Ndufs1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of NDUFS1 mRNA CTD PMID:24136188 Ndufs1 Rat folic acid multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of NDUFS1 mRNA CTD PMID:22206623 Ndufs1 Rat furfural multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of NDUFS1 protein CTD PMID:38598786 Ndufs1 Rat gallic acid multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] inhibits the reaction [Hydrogen Peroxide results in decreased expression of NDUFS1 mRNA] and BMAL1 protein affects the reaction [[Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] inhibits the reaction [Hydrogen Peroxide results in decreased expression of NDUFS1 mRNA]] CTD PMID:29061316 Ndufs1 Rat gallocatechin multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] inhibits the reaction [Hydrogen Peroxide results in decreased expression of NDUFS1 mRNA] and BMAL1 protein affects the reaction [[Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] inhibits the reaction [Hydrogen Peroxide results in decreased expression of NDUFS1 mRNA]] CTD PMID:29061316 Ndufs1 Rat genistein decreases methylation EXP 6480464 Genistein results in decreased methylation of NDUFS1 gene CTD PMID:28505145 Ndufs1 Rat hydrazine increases expression EXP 6480464 hydrazine results in increased expression of NDUFS1 protein CTD PMID:15370871 Ndufs1 Rat hydrogen peroxide decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of NDUFS1 mRNA CTD PMID:29061316 and PMID:30316844 Ndufs1 Rat hydrogen peroxide multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] inhibits the reaction [Hydrogen Peroxide results in decreased expression of NDUFS1 mRNA] and BMAL1 protein affects the reaction [[Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] inhibits the reaction [Hydrogen Peroxide results in decreased expression of NDUFS1 mRNA]] CTD PMID:29061316 Ndufs1 Rat indometacin multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in decreased expression of NDUFS1 mRNA CTD PMID:28628672 Ndufs1 Rat iron atom affects expression ISO NDUFS1 (Homo sapiens) 6480464 Iron affects the expression of NDUFS1 protein CTD PMID:11313346 Ndufs1 Rat iron(0) affects expression ISO NDUFS1 (Homo sapiens) 6480464 Iron affects the expression of NDUFS1 protein CTD PMID:11313346 Ndufs1 Rat isoniazide affects expression ISO Ndufs1 (Mus musculus) 6480464 Isoniazid affects the expression of NDUFS1 mRNA CTD PMID:24848797 Ndufs1 Rat isoprenaline multiple interactions EXP 6480464 [Isoproterenol co-treated with POSTN protein] results in decreased expression of NDUFS1 mRNA CTD PMID:30303030 Ndufs1 Rat isotretinoin decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of NDUFS1 mRNA CTD PMID:20436886 Ndufs1 Rat ivermectin decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of NDUFS1 protein CTD PMID:32959892 Ndufs1 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of NDUFS1 protein CTD PMID:18504422 Ndufs1 Rat lamivudine multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of NDUFS1 mRNA CTD PMID:18313992 Ndufs1 Rat lead diacetate increases expression ISO Ndufs1 (Mus musculus) 6480464 lead acetate results in increased expression of NDUFS1 protein CTD PMID:20797405 Ndufs1 Rat lipopolysaccharide multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of NDUFS1 mRNA CTD PMID:31059760 Ndufs1 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of NDUFS1 mRNA and Methapyrilene results in decreased expression of NDUFS1 protein CTD PMID:30467583 Ndufs1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of NDUFS1 mRNA CTD PMID:30047161 Ndufs1 Rat methylmercury chloride decreases expression ISO NDUFS1 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of NDUFS1 mRNA CTD PMID:28001369 Ndufs1 Rat methylmercury(1+) multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of NDUFS1 mRNA CTD PMID:17905399 Ndufs1 Rat monosodium L-glutamate decreases expression ISO Ndufs1 (Mus musculus) 6480464 Sodium Glutamate results in decreased expression of NDUFS1 mRNA CTD PMID:20111022 Ndufs1 Rat monosodium L-glutamate multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Ndufs1 Rat N-methyl-4-phenylpyridinium decreases expression ISO Ndufs1 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of NDUFS1 protein CTD PMID:26558463 Ndufs1 Rat N-methyl-4-phenylpyridinium multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 MIR29A inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of NDUFS1 protein] CTD PMID:36174668 Ndufs1 Rat N-methyl-4-phenylpyridinium decreases expression ISO NDUFS1 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of NDUFS1 protein CTD PMID:36174668 Ndufs1 Rat ochratoxin A decreases expression ISO NDUFS1 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of NDUFS1 protein CTD PMID:26861962 Ndufs1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NDUFS1 mRNA CTD PMID:25729387 Ndufs1 Rat ozone multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of and results in increased oxidation of NDUFS1 mRNA more ... CTD PMID:32699268 and PMID:35430440 Ndufs1 Rat paracetamol affects expression ISO Ndufs1 (Mus musculus) 6480464 Acetaminophen affects the expression of NDUFS1 mRNA CTD PMID:17562736 Ndufs1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of NDUFS1 mRNA CTD PMID:33387578 Ndufs1 Rat paracetamol multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of NDUFS1 mRNA CTD PMID:31059760 Ndufs1 Rat paracetamol decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of NDUFS1 mRNA CTD PMID:22230336 more ... Ndufs1 Rat paraquat increases expression ISO NDUFS1 (Homo sapiens) 6480464 Paraquat results in increased expression of NDUFS1 mRNA CTD PMID:34097952 Ndufs1 Rat phlorizin decreases expression ISO Ndufs1 (Mus musculus) 6480464 Phlorhizin results in decreased expression of NDUFS1 mRNA CTD PMID:22538082 Ndufs1 Rat pirinixic acid increases expression ISO Ndufs1 (Mus musculus) 6480464 pirinixic acid results in increased expression of NDUFS1 mRNA CTD PMID:23811191 Ndufs1 Rat Propiverine affects binding EXP 6480464 propiverine binds to NDUFS1 protein CTD PMID:29273565 Ndufs1 Rat Pseudolaric acid B decreases expression ISO Ndufs1 (Mus musculus) 6480464 pseudolaric acid B results in decreased expression of NDUFS1 mRNA CTD PMID:37244295 Ndufs1 Rat pyrroloquinoline quinone multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [PQQ Cofactor inhibits the reaction [Rotenone results in decreased expression of NDUFS1 mRNA]] and PQQ Cofactor inhibits the reaction [Rotenone results in decreased expression of NDUFS1 mRNA] CTD PMID:24755484 Ndufs1 Rat pyrroloquinoline quinone increases response to substance ISO NDUFS1 (Homo sapiens) 6480464 NDUFS1 mRNA results in increased susceptibility to PQQ Cofactor CTD PMID:27108097 Ndufs1 Rat pyrroloquinoline quinone increases response to substance EXP 6480464 NDUFS1 mRNA results in increased susceptibility to PQQ Cofactor CTD PMID:27108097 Ndufs1 Rat pyrroloquinoline quinone multiple interactions EXP 6480464 PQQ Cofactor inhibits the reaction [Rotenone results in decreased expression of NDUFS1 mRNA] CTD PMID:26276080 and PMID:27108097 Ndufs1 Rat quercetin decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Quercetin results in decreased expression of NDUFS1 protein CTD PMID:15221776 Ndufs1 Rat rac-lactic acid decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of NDUFS1 mRNA CTD PMID:30851411 Ndufs1 Rat resveratrol increases expression ISO NDUFS1 (Homo sapiens) 6480464 resveratrol results in increased expression of NDUFS1 protein CTD PMID:24365713 Ndufs1 Rat resveratrol multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of NDUFS1 mRNA CTD PMID:23557933 Ndufs1 Rat rotenone decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Rotenone results in decreased expression of NDUFS1 mRNA CTD PMID:24755484 Ndufs1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of NDUFS1 protein CTD PMID:35544339 Ndufs1 Rat rotenone multiple interactions EXP 6480464 Edaravone inhibits the reaction [Rotenone results in decreased expression of NDUFS1 mRNA] and PQQ Cofactor inhibits the reaction [Rotenone results in decreased expression of NDUFS1 mRNA] CTD PMID:26276080 and PMID:27108097 Ndufs1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of NDUFS1 mRNA CTD PMID:26276080 and PMID:27108097 Ndufs1 Rat rotenone multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [PQQ Cofactor inhibits the reaction [Rotenone results in decreased expression of NDUFS1 mRNA]] and PQQ Cofactor inhibits the reaction [Rotenone results in decreased expression of NDUFS1 mRNA] CTD PMID:24755484 Ndufs1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of NDUFS1 protein CTD PMID:29459688 Ndufs1 Rat sodium chloride multiple interactions ISO NDUFS1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of NDUFS1 protein CTD PMID:38598786 Ndufs1 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of NDUFS1 mRNA CTD PMID:22561333 Ndufs1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of NDUFS1 mRNA CTD PMID:30047161 Ndufs1 Rat sulforaphane increases expression ISO Ndufs1 (Mus musculus) 6480464 sulforaphane results in increased expression of NDUFS1 mRNA CTD PMID:30529165 Ndufs1 Rat sunitinib decreases expression ISO Ndufs1 (Mus musculus) 6480464 Sunitinib results in decreased expression of NDUFS1 mRNA CTD PMID:31445075 Ndufs1 Rat T-2 toxin increases expression EXP 6480464 T-2 Toxin results in increased expression of NDUFS1 mRNA CTD PMID:29870751 Ndufs1 Rat tapentadol decreases expression ISO NDUFS1 (Homo sapiens) 6480464 tapentadol results in decreased expression of NDUFS1 mRNA CTD PMID:27317026 Ndufs1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NDUFS1 mRNA] CTD PMID:31150632 Ndufs1 Rat tetrachloromethane decreases expression ISO Ndufs1 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of NDUFS1 mRNA CTD PMID:31919559 Ndufs1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of NDUFS1 mRNA CTD PMID:31150632 Ndufs1 Rat thiram decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Thiram results in decreased expression of NDUFS1 mRNA CTD PMID:38568856 Ndufs1 Rat titanium dioxide decreases methylation ISO Ndufs1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of NDUFS1 gene CTD PMID:35295148 Ndufs1 Rat toluene affects expression EXP 6480464 Toluene affects the expression of NDUFS1 mRNA CTD PMID:21827849 Ndufs1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of NDUFS1 mRNA CTD PMID:25729387 Ndufs1 Rat tramadol decreases expression ISO NDUFS1 (Homo sapiens) 6480464 Tramadol results in decreased expression of NDUFS1 mRNA CTD PMID:27317026 Ndufs1 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in increased expression of NDUFS1 mRNA CTD PMID:31129395 Ndufs1 Rat trichloroethene multiple interactions EXP 6480464 [Benzene co-treated with methylmercury II co-treated with Trichloroethylene] results in increased expression of NDUFS1 mRNA CTD PMID:17905399 Ndufs1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of NDUFS1 gene CTD PMID:27618143 Ndufs1 Rat triphenyl phosphate affects expression ISO NDUFS1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NDUFS1 mRNA CTD PMID:37042841 Ndufs1 Rat triptonide increases expression ISO Ndufs1 (Mus musculus) 6480464 triptonide results in increased expression of NDUFS1 mRNA CTD PMID:33045310 Ndufs1 Rat valproic acid decreases methylation ISO NDUFS1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of NDUFS1 gene CTD PMID:29154799 Ndufs1 Rat valproic acid affects expression ISO NDUFS1 (Homo sapiens) 6480464 Valproic Acid affects the expression of NDUFS1 mRNA CTD PMID:25979313 Ndufs1 Rat valproic acid increases expression ISO NDUFS1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of NDUFS1 mRNA CTD PMID:23179753 and PMID:28001369 Ndufs1 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of NDUFS1 mRNA CTD PMID:23034163 Ndufs1 Rat zidovudine increases expression ISO NDUFS1 (Homo sapiens) 6480464 Zidovudine results in increased expression of NDUFS1 mRNA CTD PMID:16894629 Ndufs1 Rat zidovudine multiple interactions ISO Ndufs1 (Mus musculus) 6480464 [Zidovudine co-treated with Lamivudine] results in increased expression of NDUFS1 mRNA CTD PMID:18313992
Imported Annotations - KEGG (archival)
(+)-epicatechin-3-O-gallate (ISO) (+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) (R,R)-tramadol (ISO) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) aflatoxin B1 (ISO) alpha-naphthoflavone (ISO) alpha-pinene (ISO) amiodarone (ISO) amitrole (EXP) Aroclor 1254 (ISO) arsenite(3-) (ISO) arsenous acid (ISO) aspartame (ISO) benzene (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) Brodifacoum (EXP) Butylbenzyl phthalate (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (EXP) calcium atom (EXP) calcium(0) (EXP) chlorpyrifos (ISO) clofibric acid (EXP) copper atom (EXP) copper(0) (EXP) copper(II) chloride (ISO) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) diethyl phthalate (ISO) dihydroxyacetone (EXP) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dioxygen (EXP) dopamine (ISO) doxorubicin (ISO) edaravone (EXP) ethanol (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) furfural (ISO) gallic acid (ISO) gallocatechin (ISO) genistein (EXP) hydrazine (EXP) hydrogen peroxide (ISO) indometacin (ISO) iron atom (ISO) iron(0) (ISO) isoniazide (ISO) isoprenaline (EXP) isotretinoin (ISO) ivermectin (ISO) ketamine (EXP) lamivudine (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) methapyrilene (EXP) methimazole (EXP) methylmercury chloride (ISO) methylmercury(1+) (EXP) monosodium L-glutamate (ISO) N-methyl-4-phenylpyridinium (ISO) ochratoxin A (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) phlorizin (ISO) pirinixic acid (ISO) Propiverine (EXP) Pseudolaric acid B (ISO) pyrroloquinoline quinone (EXP,ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) rotenone (EXP,ISO) sodium arsenite (EXP) sodium chloride (ISO) sodium dichromate (EXP) sulfadimethoxine (EXP) sulforaphane (ISO) sunitinib (ISO) T-2 toxin (EXP) tapentadol (ISO) tetrachloromethane (EXP,ISO) thiram (ISO) titanium dioxide (ISO) toluene (EXP) topotecan (EXP) tramadol (ISO) tributylstannane (EXP) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) zidovudine (ISO)
1.
Large-scale deletion and point mutations of the nuclear NDUFV1 and NDUFS1 genes in mitochondrial complex I deficiency.
Benit P, etal., Am J Hum Genet 2001 Jun;68(6):1344-52. Epub 2001 May 7.
2.
Quantitative mapping of reversible mitochondrial Complex I cysteine oxidation in a Parkinson disease mouse model.
Danielson SR, etal., J Biol Chem. 2011 Mar 4;286(9):7601-8. Epub 2011 Jan 1.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
GSH monoethyl ester rescues mitochondrial defects in cystic fibrosis models.
Kelly-Aubert M, etal., Hum Mol Genet. 2011 Jul 15;20(14):2745-59. Epub 2011 Apr 25.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Comprehensive gene review and curation
RGD comprehensive gene curation
12.
Caloric restriction primes mitochondria for ischemic stress by deacetylating specific mitochondrial proteins of the electron transport chain.
Shinmura K, etal., Circ Res. 2011 Aug 5;109(4):396-406. doi: 10.1161/CIRCRESAHA.111.243097. Epub 2011 Jun 23.
13.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Ndufs1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 72,040,286 - 72,073,605 (-) NCBI GRCr8 mRatBN7.2 9 64,546,430 - 64,579,751 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 64,546,225 - 64,579,893 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 73,049,877 - 73,083,200 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 78,170,168 - 78,204,120 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 76,476,771 - 76,510,751 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 69,919,863 - 69,953,182 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 69,919,867 - 69,953,182 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 69,728,932 - 69,762,079 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 61,798,141 - 61,831,964 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 61,945,124 - 61,978,946 (-) NCBI Celera 9 61,964,379 - 61,997,783 (-) NCBI Celera Cytogenetic Map 9 q32 NCBI
NDUFS1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 206,114,817 - 206,159,444 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 206,114,817 - 206,159,509 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 206,979,541 - 207,024,168 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 206,696,048 - 206,732,432 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 206,813,308 - 206,849,693 NCBI Celera 2 200,745,218 - 200,781,616 (-) NCBI Celera Cytogenetic Map 2 q33.3 NCBI HuRef 2 198,836,332 - 198,872,823 (-) NCBI HuRef CHM1_1 2 206,994,334 - 207,030,799 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 206,596,710 - 206,641,337 (-) NCBI T2T-CHM13v2.0
Ndufs1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 63,182,751 - 63,215,981 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 63,182,755 - 63,215,992 (-) Ensembl GRCm39 Ensembl GRCm38 1 63,143,592 - 63,176,822 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 63,143,596 - 63,176,833 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 63,190,166 - 63,223,396 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 63,077,874 - 63,110,985 (-) NCBI MGSCv36 mm8 Celera 1 63,653,959 - 63,687,212 (-) NCBI Celera Cytogenetic Map 1 C2 NCBI cM Map 1 32.29 NCBI
Ndufs1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955457 8,838,216 - 8,883,481 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955457 8,838,216 - 8,879,059 (+) NCBI ChiLan1.0 ChiLan1.0
NDUFS1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 108,735,668 - 108,773,190 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 108,751,932 - 108,788,172 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 93,363,092 - 93,399,326 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 211,493,021 - 211,528,496 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 211,493,021 - 211,528,496 (-) Ensembl panpan1.1 panPan2
NDUFS1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 37 14,680,908 - 14,713,838 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 37 14,683,083 - 14,713,754 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 37 15,557,654 - 15,590,612 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 37 14,616,264 - 14,649,231 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 37 14,616,260 - 14,649,178 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 37 14,570,542 - 14,603,481 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 37 14,542,759 - 14,575,738 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 37 14,539,074 - 14,572,034 (-) NCBI UU_Cfam_GSD_1.0
Ndufs1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 162,868,082 - 162,903,922 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936631 2,499,062 - 2,538,801 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936631 2,503,353 - 2,538,957 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NDUFS1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 109,409,771 - 109,451,676 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 109,413,726 - 109,451,813 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 120,962,189 - 121,000,375 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NDUFS1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 91,893,337 - 91,927,559 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 91,893,616 - 91,927,592 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 107,451,554 - 107,485,782 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ndufs1
.
Predicted Target Of
Count of predictions: 64 Count of miRNA genes: 50 Interacting mature miRNAs: 62 Transcripts: ENSRNOT00000015852 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7411571 Bw138 Body weight QTL 138 14.3 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 9 32535505 77535505 Rat 11353957 Bmd92 Bone mineral density QTL 92 0.01 tibia mineral mass (VT:1000283) volumetric bone mineral density (CMO:0001553) 9 46114199 91114199 Rat 631680 Cm11 Cardiac mass QTL 11 3.1 0.00089 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 9 20430519 65430519 Rat 61385 Edpm9 Estrogen-dependent pituitary mass QTL 9 3.43 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 63869687 108869687 Rat 70218 Cm28 Cardiac mass QTL 28 8.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 25268044 79271759 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 1578760 Cm53 Cardiac mass QTL 53 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 56771635 101771635 Rat 631643 Bp120 Blood pressure QTL 120 3 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 22071200 67071200 Rat 1581580 Uae34 Urinary albumin excretion QTL 34 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 62072275 96470995 Rat 12879506 Pur33 Proteinuria QTL 33 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 44649921 89649921 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 1598849 Memor17 Memory QTL 17 2.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) 9 49968546 71098346 Rat 10058949 Gmadr5 Adrenal mass QTL 5 2 0.014 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 9 42791513 87976209 Rat 1578757 Pur6 Proteinuria QTL 6 3.3 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 62072275 96470995 Rat 631656 Bp108 Blood pressure QTL 108 5.97 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 48598251 93598251 Rat 2303170 Bp332 Blood pressure QTL 332 3.73 0.027 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 55847841 77026453 Rat 8662828 Vetf6 Vascular elastic tissue fragility QTL 6 3.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 9 36962359 92058970 Rat 61352 Bp34 Blood pressure QTL 34 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 42495343 79271511 Rat 724515 Uae16 Urinary albumin excretion QTL 16 8 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 58163035 100929646 Rat 731171 Glom6 Glomerulus QTL 6 2.8 0.0003 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 9 64573531 109573531 Rat 1598834 Memor11 Memory QTL 11 2.5 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 9 36962359 77814038 Rat 70186 Niddm26 Non-insulin dependent diabetes mellitus QTL 26 3.87 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 9 22071169 86369743 Rat 7207814 Bmd91 Bone mineral density QTL 91 3.5 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 9 23754144 83851531 Rat 6903941 Pur31 Proteinuria QTL 31 0.036 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 9 40194188 85194188 Rat 2303180 Bp333 Blood pressure QTL 333 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 56627713 78595166 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 11353949 Bp393 Blood pressure QTL 393 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 40194188 85194188 Rat 11353951 Bp394 Blood pressure QTL 394 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 44649921 89649921 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 1300134 Bp185 Blood pressure QTL 185 3.73 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 61381434 104821652 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 7411656 Foco26 Food consumption QTL 26 9.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 32535505 77535505 Rat 1578659 Tspe1 Trichinella spiralis expulsion QTL 1 4.8 parasite quantity (VT:0010441) logarithm of the intestinal adult Trichinella spiralis count (CMO:0002024) 9 61381434 65691299 Rat 1641894 Alcrsp12 Alcohol response QTL 12 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 27468639 72468639 Rat
RH134359
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 64,546,412 - 64,546,625 (+) MAPPER mRatBN7.2 Rnor_6.0 9 69,919,846 - 69,920,058 NCBI Rnor6.0 Rnor_5.0 9 69,728,915 - 69,729,127 UniSTS Rnor5.0 RGSC_v3.4 9 61,798,124 - 61,798,336 UniSTS RGSC3.4 Celera 9 61,964,362 - 61,964,574 UniSTS RH 3.4 Map 9 530.1 UniSTS Cytogenetic Map 9 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015852 ⟹ ENSRNOP00000015851
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 64,546,225 - 64,579,809 (-) Ensembl Rnor_6.0 Ensembl 9 69,919,867 - 69,953,182 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098172 ⟹ ENSRNOP00000083908
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 64,546,225 - 64,575,129 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104288 ⟹ ENSRNOP00000087012
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 64,546,243 - 64,579,893 (-) Ensembl
RefSeq Acc Id:
NM_001005550 ⟹ NP_001005550
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 72,040,286 - 72,073,605 (-) NCBI mRatBN7.2 9 64,546,430 - 64,579,751 (-) NCBI Rnor_6.0 9 69,919,863 - 69,953,182 (-) NCBI Rnor_5.0 9 69,728,932 - 69,762,079 (-) NCBI RGSC_v3.4 9 61,798,141 - 61,831,964 (-) RGD Celera 9 61,964,379 - 61,997,783 (-) RGD
Sequence:
GGGGTCAGGGGGATCCGGACAAATCAGCGGGACAACTTGGTGAGCTCTAGAGGAAAGCCATCATGTTAAGGATACCTGTAAAAAGGGCCTTGATAGGCCTTTCTAAGTCTCCTAAAGGATATGTTCGA
hide sequence
RefSeq Acc Id:
NP_001005550 ⟸ NM_001005550
- Peptide Label:
precursor
- UniProtKB:
Q66HF1 (UniProtKB/Swiss-Prot), A6IPF8 (UniProtKB/TrEMBL), A0A8I5ZXM3 (UniProtKB/TrEMBL)
- Sequence:
MLRIPVKRALIGLSKSPKGYVRSTGTAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDC
hide sequence
Ensembl Acc Id:
ENSRNOP00000015851 ⟸ ENSRNOT00000015852
Ensembl Acc Id:
ENSRNOP00000083908 ⟸ ENSRNOT00000098172
Ensembl Acc Id:
ENSRNOP00000087012 ⟸ ENSRNOT00000104288
RGD ID: 13696710 Promoter ID: EPDNEW_R7235 Type: multiple initiation site Name: Ndufs1_1 Description: NADH:ubiquinone oxidoreductase core subunit S1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 9 69,953,221 - 69,953,281 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-03-29
Ndufs1
NADH:ubiquinone oxidoreductase core subunit S1
Ndufs1
NADH dehydrogenase (ubiquinone) Fe-S protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Ndufs1
NADH dehydrogenase (ubiquinone) Fe-S protein 1
NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa
Name updated
1299863 APPROVED
2005-07-29
Ndufs1
NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa
Symbol and Name status set to provisional
70820 PROVISIONAL
