Advanced Search (OLGA)

Gene: Ier2 (immediate early response 2) Rattus norvegicus

Analyze

Symbol:

Ier2

Name:

immediate early response 2

RGD ID:

1359581

Description:

Involved in neuron differentiation and response to fibroblast growth factor. Predicted to be located in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in colorectal cancer and hepatocellular carcinoma. Orthologous to human IER2 (immediate early response 2); INTERACTS WITH 17beta-estradiol; 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

immediate early response gene 2 protein; MGC72578; similar to immediate early response 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IER2 (immediate early response 2)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Ier2 (immediate early response 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ier2 (immediate early response 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IER2 (immediate early response 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IER2 (immediate early response 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ier2 (immediate early response 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IER2 (immediate early response 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IER2 (immediate early response 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ier2 (immediate early response 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ier2 (immediate early response 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	IER2 (immediate early response 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ier2 (immediate early response 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ier2a	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ier2b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ier2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	40,399,373 - 40,400,897 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	40,398,160 - 40,402,708 (+)	Ensembl				GRCr8
mRatBN7.2	19	23,494,551 - 23,496,075 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,494,184 - 23,499,211 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	30,317,473 - 30,318,997 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	30,971,850 - 30,973,374 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	33,194,540 - 33,196,064 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	25,774,146 - 25,775,670 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	25,774,143 - 25,775,659 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	36,750,509 - 36,752,033 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	25,159,276 - 25,160,800 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	23,048,157 - 23,049,681 (+)	NCBI		Celera
RGSC_v3.1	19	25,164,101 - 25,165,622 (+)	NCBI
Cytogenetic Map	19	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

childhood acute myeloid leukemia (ISO)

colorectal adenocarcinoma (ISO)

colorectal cancer (ISO)

COVID-19 (ISO)

hepatocellular carcinoma (ISO)

Lung Neoplasms (ISO)

Lymphatic Metastasis (IMP)

melanoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-palmitoylglycerol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

acrylamide (ISO)

afimoxifene (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amitrole (EXP)

amphetamine (EXP)

antimony(0) (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

azathioprine (ISO)

azoxystrobin (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bexarotene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (EXP,ISO)

calciol (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

chromium atom (ISO)

chromium(6+) (ISO)

ciglitazone (EXP)

cisplatin (ISO)

clofibrate (ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

diallyl trisulfide (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP,ISO)

dieldrin (ISO)

diethyl phthalate (ISO)

diisobutyl phthalate (ISO)

diisononyl phthalate (ISO)

dimethyl sulfoxide (EXP)

dioxygen (EXP)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

dorsomorphin (ISO)

ellagic acid (ISO)

Enterolactone (ISO)

ethyl methanesulfonate (ISO)

fentin chloride (EXP)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (ISO)

glycidol (EXP)

glyphosate (ISO)

GSK-J4 (ISO)

hydrogen peroxide (ISO)

inulin (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

mercury dichloride (EXP)

methamphetamine (EXP)

methotrexate (ISO)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodimethylamine (ISO)

nickel dichloride (ISO)

nickel sulfate (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

p-chloromercuribenzoic acid (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenformin (EXP)

phenobarbital (ISO)

phorbol 13-acetate 12-myristate (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

propiconazole (EXP,ISO)

quercetin (ISO)

resveratrol (ISO)

rotenone (EXP,ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sodium dichromate (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (ISO)

theophylline (ISO)

thiram (ISO)

titanium dioxide (ISO)

topotecan (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

valsartan (ISO)

vinclozolin (EXP)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell motility (IEA,ISO,ISS)

neuron differentiation (IDA)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

response to fibroblast growth factor (IDA)

Cellular Component

cytoplasm (IEA,ISO,ISS)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO,ISS)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	DNA methylome in visceral adipose tissue can discriminate patients with and without colorectal cancer.	Izquierdo AG, etal., Epigenetics. 2022 Jun;17(6):665-676. doi: 10.1080/15592294.2021.1950991. Epub 2021 Jul 26.
2.	IER2-induced senescence drives melanoma invasion through osteopontin.	Kyjacova L, etal., Oncogene. 2021 Nov;40(47):6494-6512. doi: 10.1038/s41388-021-02027-6. Epub 2021 Oct 5.
3.	CircRNF220, not its linear cognate gene RNF220, regulates cell growth and is associated with relapse in pediatric acute myeloid leukemia.	Liu X, etal., Mol Cancer. 2021 Oct 26;20(1):139. doi: 10.1186/s12943-021-01395-7.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	The immediate early gene Ier2 promotes tumor cell motility and metastasis, and predicts poor survival of colorectal cancer patients.	Neeb A, etal., Oncogene. 2012 Aug 16;31(33):3796-806. doi: 10.1038/onc.2011.535. Epub 2011 Nov 28.
6.	JNK- and Rac1-dependent induction of immediate early gene pip92 suppresses neuronal differentiation.	Park JB, etal., J Neurochem. 2007 Jan;100(2):555-66. Epub 2006 Nov 29.
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
10.	Immediate early response protein 2 promotes the migration and invasion of hepatocellular carcinoma cells via regulating the activity of Rho GTPases.	Xu X, etal., Neoplasma. 2020 May;67(3):614-622. doi: 10.4149/neo_2020_190818N781. Epub 2020 Feb 3.

Additional References at PubMed

PMID:2247083	PMID:15192077	PMID:15489334	PMID:19584537

Genomics

Comparative Map Data

Ier2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	40,399,373 - 40,400,897 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	40,398,160 - 40,402,708 (+)	Ensembl				GRCr8
mRatBN7.2	19	23,494,551 - 23,496,075 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	23,494,184 - 23,499,211 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	30,317,473 - 30,318,997 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	30,971,850 - 30,973,374 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	33,194,540 - 33,196,064 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	25,774,146 - 25,775,670 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	25,774,143 - 25,775,659 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	36,750,509 - 36,752,033 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	25,159,276 - 25,160,800 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	23,048,157 - 23,049,681 (+)	NCBI		Celera
RGSC_v3.1	19	25,164,101 - 25,165,622 (+)	NCBI
Cytogenetic Map	19	q11	NCBI

IER2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	13,150,411 - 13,154,911 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	13,150,411 - 13,156,981 (+)	Ensembl			hg38	GRCh38
GRCh37	19	13,261,225 - 13,265,725 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	13,122,282 - 13,126,722 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	13,122,281 - 13,126,716	NCBI
Celera	19	13,151,680 - 13,156,120 (+)	NCBI		Celera
Cytogenetic Map	19	p13.13	NCBI
HuRef	19	12,833,675 - 12,838,116 (+)	NCBI		HuRef
CHM1_1	19	13,262,236 - 13,266,676 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	13,275,624 - 13,280,125 (+)	NCBI		T2T-CHM13v2.0

Ier2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	85,387,960 - 85,389,481 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	85,387,960 - 85,389,483 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	84,661,331 - 84,662,852 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	84,661,331 - 84,662,854 (-)	Ensembl			mm10	GRCm38
MGSCv37	8	87,185,230 - 87,186,751 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	87,549,656 - 87,552,953 (-)	NCBI		MGSCv36	mm8
Celera	8	88,961,236 - 88,962,757 (-)	NCBI		Celera
Cytogenetic Map	8	C3	NCBI
cM Map	8	41.02	NCBI

Ier2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	32,159,935 - 32,160,624 (+)	Ensembl
ChiLan1.0	NW_004955415	32,159,762 - 32,161,530 (+)	NCBI	ChiLan1.0	ChiLan1.0

IER2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	18,081,380 - 18,085,241 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	17,082,479 - 17,085,886 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	12,714,804 - 12,718,213 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	13,449,491 - 13,452,925 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	13,452,239 - 13,452,910 (+)	Ensembl			panPan2	panpan1.1

IER2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	49,071,243 - 49,074,184 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	49,072,234 - 49,072,902 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	48,944,380 - 48,946,236 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	49,588,863 - 49,590,720 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	49,588,864 - 49,590,663 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	48,800,441 - 48,802,297 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	49,226,806 - 49,228,663 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	49,469,195 - 49,471,051 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ier2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	208,174,816 - 208,177,770 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	2,178,312 - 2,178,983 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936659	2,176,962 - 2,179,900 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IER2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	65,909,651 - 65,912,445 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	65,909,638 - 65,912,491 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	66,210,147 - 66,211,956 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IER2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	11,834,998 - 11,838,421 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	11,836,706 - 11,837,377 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666074	7,945,206 - 7,948,333 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ier2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624901	684,966 - 685,652 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624901	684,313 - 686,488 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ier2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	17	15,629,547 - 15,631,128 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ier2
6 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	116
Count of miRNA genes:	93
Interacting mature miRNAs:	94
Transcripts:	ENSRNOT00000072329
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	7997750	52997750	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	19220689	64220689	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	7997750	52997750	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	5748064	50748064	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	32365311	74246245	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	24093973	69093973	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
2303628	Vencon9	Ventilatory control QTL 9		0.005	respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	19	23188586	68188586	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	32539615	74246245	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	31287532	51431640	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	31777888	74246245	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	7997750	52997750	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	7997750	52997750	Rat
1554318	Bmd5	Bone mineral density QTL 5	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	19	23188586	68188586	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	20109306	65109306	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat
61407	Scl12	Serum cholesterol level QTL 12		0.001	blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	19	30099383	47207961	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120246	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061717	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC158596	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000088175

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	19	25,774,143 - 25,775,659 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116299 ⟹ ENSRNOP00000090794

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	23,494,184 - 23,499,211 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000143896 ⟹ ENSRNOP00000103402

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	40,398,160 - 40,400,887 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000154538 ⟹ ENSRNOP00000103117

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	40,399,351 - 40,402,708 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000166619 ⟹ ENSRNOP00000103930

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	40,399,093 - 40,400,889 (+)	Ensembl

RefSeq Acc Id:

NM_001009541 ⟹ NP_001009541

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	40,399,373 - 40,400,897 (+)	NCBI
mRatBN7.2	19	23,494,551 - 23,496,075 (+)	NCBI
Rnor_6.0	19	25,774,146 - 25,775,670 (-)	NCBI
Rnor_5.0	19	36,750,509 - 36,752,033 (-)	NCBI
RGSC_v3.4	19	25,159,276 - 25,160,800 (+)	RGD
Celera	19	23,048,157 - 23,049,681 (+)	RGD

Sequence:

show sequence

AGTACCTGCAACTGTAAGTGAGTCGTCTAGGCAGCAACGCCGGTCTTAATCCATTGTCGGCTTA
ACTCTACACAGTCGTCGAACAAGCATGGAAGTACAGAAAGAAGCGCAGCGCATCATGACACTGT
CCGTGTGGAAGATGTACCACTCTCGCATGCAGCGCGGTGGCTTGCGCCTCCACCGGAGTCTGCA
GCTGTCCCTCGTTATGCGCAGCGCTCGGGAGCTCTACCTCTCAGCCAAGGTAGAAACCCACCAG
CCCGAGTTCCCGCCATCCCGCAGGGCCCTTGACCCTCGCCTGCACCCGCCGCGAGAACCCGAAG
CTGCAATGGAAGCAGCGACCCCTGACGTCGAGCAGCCTCCGGAGCCCATGGACACGCAAGAGGA
AGTGCTGCGAGTCCAGGAGACCCCCGCGCTCTGTGACCCGCCCCCCGCTAGAGTCAGCCGCAAG
CGCCGGAGTAGCAGCGACTTGAGCGACGGTAGTGATGCCGGACTGGTACCAAGCAAGAAGGCCC
GTCTGGAAGAGGTGGAGGGGGAGGCGACGTCGGAGGTCTCCAATCGCCTGCAGCTTCCTCCCGC
ACAAACCGAAGGTGCCTTCCCTAACCTCGCCCGCGTCCTCCAAAGGCGCTTCTCCAGTCTCTTG
AACTGTGGGCCCGCCGTGCCCCCGCCGACGCCCCCCACGTGCGAGGCCAAGCCAGCCTGCCGCC
CGGCCGACAATATGCTCAACGTGCTGGTGCGAACCGTGGTGGCCTTCTGAGGATTACGAGCGGC
GCCACCGGAGCGGAGAACGCACACCCGAGGCGAAGGCCGGCGGGGGGCCGTAAAGAAGAGCCGC
GGCCCGAGCTGCCGAGAGGCCAGGGGAAGGACTGAGGAGCTAGGAGCTAGGGGCGCGGGCGCCT
TCTCCCAGACGTACGTCCACAGGTGCTATTAAAGGACTGTCCCTTCCTTGGTTTGGAGAAGGGA
CACCTGGATCTTGAATCTCAGGGTCGGACTCTCTAGGGCCCAGGCTGCCCTTTCAAGGCCGTTT
CACTAGCATTCGCGTTTCGGCCCCTACAAGTGGGCACGCTTGTGCAAGCGGTCAGAGTTGCGTC
ATGGGACAGACGCGGGTGCTTCCTGTTGCCTTGCGTGGGTGTGGGGCCTGGGAGGAGGCCAGGG
TGTGGACCCGCCCTAGGGACTGGGAAGTGACTTGAGTCACCTCGCCCCCACAGGCTGCTGTGGG
CGAGCCGGCCTTCGGCTGAGATCCAGAACTGAACAAATCAAATCTTGCTGCGATCAGAGTTGAT
TGAAGTGGCTGGAGACCCCGGGACTGGTCAGCCTAGACTGATCGCCTGGCGTGGACTACCGCGG
AAAGGGTGGGTGGGTGGTCTCATTTGCTGTCTTAGACACGACCTCTTCGGGCAAGATAGAATTT
TTTACCAGCGAATTTAAGAAAGTCTGTTTACTTTTCCCACGGTGGGTTGTGTTTAACTCCCAAC
TACCTGGAGTTTTACAATGTCAGCTAGGAAAATAAAAGTCCATCGGTGTAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009541	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61717	(Get FASTA)	NCBI Sequence Viewer
	AAI58597	(Get FASTA)	NCBI Sequence Viewer
	EDL92216	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000090794.1
	ENSRNOP00000103930
GenBank Protein	Q6P7D3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009541 ⟸ NM_001009541

- UniProtKB:

Q6P7D3 (UniProtKB/Swiss-Prot), A6IY88 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEVQKEAQRIMTLSVWKMYHSRMQRGGLRLHRSLQLSLVMRSARELYLSAKVETHQPEFPPSRR
ALDPRLHPPREPEAAMEAATPDVEQPPEPMDTQEEVLRVQETPALCDPPPARVSRKRRSSSDLS
DGSDAGLVPSKKARLEEVEGEATSEVSNRLQLPPAQTEGAFPNLARVLQRRFSSLLNCGPAVPP
PTPPTCEAKPACRPADNMLNVLVRTVVAF

hide sequence

Ensembl Acc Id:

ENSRNOP00000090794 ⟸ ENSRNOT00000116299

Ensembl Acc Id:

ENSRNOP00000103930 ⟸ ENSRNOT00000166619

Ensembl Acc Id:

ENSRNOP00000103117 ⟸ ENSRNOT00000154538

Ensembl Acc Id:

ENSRNOP00000103402 ⟸ ENSRNOT00000143896

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6P7D3-F1-model_v2	AlphaFold	Q6P7D3	1-221	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359581	AgrOrtholog
BioCyc Gene	G2FUF-6107	BioCyc
Ensembl Genes	ENSRNOG00000054344	Ensembl
	ENSRNOG00000067274	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000074928	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000116299.1	UniProtKB/Swiss-Prot
	ENSRNOT00000166619	ENTREZGENE
IMAGE_CLONE	IMAGE:5598375	IMAGE-MGC_LOAD
InterPro	IER	UniProtKB/Swiss-Prot
KEGG Report	rno:494344	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72578	IMAGE-MGC_LOAD
NCBI Gene	494344	ENTREZGENE
PANTHER	PTHR15895	UniProtKB/Swiss-Prot
Pfam	IER	UniProtKB/Swiss-Prot
PhenoGen	Ier2	PhenoGen
RatGTEx	ENSRNOG00000054344	RatGTEx
	ENSRNOG00000067274	RatGTEx
	ENSRNOG00000074928	RatGTEx
UniProt	A6IY88	ENTREZGENE, UniProtKB/TrEMBL
	B0BMX1_RAT	UniProtKB/TrEMBL
	IER2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-11-17	Ier2	immediate early response 2			Symbol and Name updated	1299863	APPROVED
2005-07-29	MGC72578	similar to immediate early response 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD