Advanced Search (OLGA)

Gene: Them6 (thioesterase superfamily member 6) Rattus norvegicus

Analyze

Symbol:

Them6

Name:

thioesterase superfamily member 6

RGD ID:

1359378

Description:

Predicted to be located in extracellular region. Orthologous to human THEM6 (thioesterase superfamily member 6); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

mesenchymal stem cell protein DSCD75; MGC94661; RGD1359378; UPF0670 protein C8orf55 homolog; UPF0670 protein THEM6 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	THEM6 (thioesterase superfamily member 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Them6 (thioesterase superfamily member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Them6 (thioesterase superfamily member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	THEM6 (thioesterase superfamily member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	THEM6 (thioesterase superfamily member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Them6 (thioesterase superfamily member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	THEM6 (thioesterase superfamily member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	THEM6 (thioesterase superfamily member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Them6 (thioesterase superfamily member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Them6 (thioesterase superfamily member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RAB6A (RAB6A, member RAS oncogene family)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	THEM6 (thioesterase superfamily member 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Them6 (thioesterase superfamily member 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch73-52e5.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch73-52e5.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4660	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YBR096W	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YBR096W	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Danio rerio (zebrafish):	them6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG4666	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	them6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Candidate Gene For:

Bp335

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	108,495,554 - 108,498,731 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	108,495,569 - 108,498,904 (+)	Ensembl				GRCr8
mRatBN7.2	7	106,606,570 - 106,609,747 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	106,606,570 - 106,609,746 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	108,364,878 - 108,367,982 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	110,588,558 - 110,591,662 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	110,534,487 - 110,537,591 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	115,956,276 - 115,959,453 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	115,956,276 - 115,959,453 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	115,861,665 - 115,864,842 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	112,835,301 - 112,838,479 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	103,007,718 - 103,010,896 (+)	NCBI		Celera
RGSC_v3.1	7	112,869,530 - 112,872,708 (+)	NCBI
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

benzo[a]pyrene (EXP,ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

bortezomib (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

Dibutyl phosphate (ISO)

dioxygen (ISO)

diquat (ISO)

disulfiram (ISO)

endosulfan (EXP)

Enterolactone (ISO)

fenthion (ISO)

fluoranthene (ISO)

formaldehyde (ISO)

genistein (ISO)

hydralazine (ISO)

indole-3-methanol (EXP)

iron dichloride (ISO)

ivermectin (ISO)

lipopolysaccharide (ISO)

maneb (ISO)

mercury atom (ISO)

mercury(0) (ISO)

methidathion (ISO)

Moniliformin (ISO)

nitrates (ISO)

orphenadrine (EXP)

paraquat (ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloroethene (ISO)

thioacetamide (EXP)

thiram (ISO)

trichloroethene (EXP)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

Cellular Component

extracellular region (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	null	JRS Domain-based curation
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Genomics

Comparative Map Data

Them6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	108,495,554 - 108,498,731 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	108,495,569 - 108,498,904 (+)	Ensembl				GRCr8
mRatBN7.2	7	106,606,570 - 106,609,747 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	106,606,570 - 106,609,746 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	108,364,878 - 108,367,982 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	110,588,558 - 110,591,662 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	110,534,487 - 110,537,591 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	115,956,276 - 115,959,453 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	115,956,276 - 115,959,453 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	115,861,665 - 115,864,842 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	112,835,301 - 112,838,479 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	103,007,718 - 103,010,896 (+)	NCBI		Celera
RGSC_v3.1	7	112,869,530 - 112,872,708 (+)	NCBI
Cytogenetic Map	7	q34	NCBI

THEM6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	142,727,223 - 142,736,927 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	142,727,191 - 142,736,938 (+)	Ensembl			hg38	GRCh38
GRCh37	8	143,808,641 - 143,818,345 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	143,805,623 - 143,815,352 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	8	140,119,708 - 140,129,412 (+)	NCBI		Celera
Cytogenetic Map	8	q24.3	NCBI
HuRef	8	139,061,275 - 139,071,020 (+)	NCBI		HuRef
CHM1_1	8	143,848,894 - 143,858,623 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	8	143,870,611 - 143,880,316 (+)	NCBI		T2T-CHM13v2.0

Them6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	74,593,083 - 74,596,222 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	74,593,053 - 74,596,488 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	15	74,721,234 - 74,724,373 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	74,721,204 - 74,724,639 (+)	Ensembl			mm10	GRCm38
MGSCv37	15	74,551,664 - 74,554,803 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	15	74,548,489 - 74,551,628 (+)	NCBI		MGSCv36	mm8
Celera	15	76,226,179 - 76,229,191 (+)	NCBI		Celera
Cytogenetic Map	15	D3	NCBI
cM Map	15	34.26	NCBI

Them6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955454	1,433,644 - 1,438,156 (+)	Ensembl
ChiLan1.0	NW_004955454	1,433,644 - 1,438,156 (+)	NCBI	ChiLan1.0	ChiLan1.0

THEM6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	160,162,870 - 160,172,671 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	135,689,102 - 135,698,873 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	139,438,777 - 139,448,541 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	142,483,341 - 142,492,912 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	142,483,341 - 142,492,912 (+)	Ensembl			panPan2	panpan1.1

THEM6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	36,781,892 - 36,787,099 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	36,658,882 - 36,662,862 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	37,186,302 - 37,190,283 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	37,185,934 - 37,189,024 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	36,905,020 - 36,908,998 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	36,994,650 - 36,998,626 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	37,416,744 - 37,420,727 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Them6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	1,711,254 - 1,714,943 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	9,136,768 - 9,141,055 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	9,138,779 - 9,141,016 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

THEM6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	1,471,462 - 1,475,578 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	4	1,471,458 - 1,476,104 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

THEM6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	136,980,611 - 136,989,289 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	136,980,609 - 136,989,294 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666039	2,965,842 - 2,974,634 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Them6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624735	13,909,890 - 13,914,795 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624735	13,910,570 - 13,914,528 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Them6
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	247,463,993 - 247,467,278 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Them6
6 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	115
Count of miRNA genes:	83
Interacting mature miRNAs:	99
Transcripts:	ENSRNOT00000007773
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	92388565	119280177	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	104186212	135371468	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	31770293	110435881	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	73618702	118618702	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	93302009	131686183	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	71621154	114982716	Rat
61397	Bw17	Body weight QTL 17	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	7	95485047	137014596	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	85497398	130497398	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
1331723	Bw25	Body weight QTL 25	3.348		body mass (VT:0001259)	body weight (CMO:0000012)	7	96700404	111672180	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	98549867	137014596	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	63889858	108889858	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	73557047	118557047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	96700404	118618702	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
10450862	Kidm55	Kidney mass QTL 55	4.9		kidney mass (VT:0002707)	kidney weight (CMO:0000081)	7	72725037	117725037	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	100548246	137014596	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	63889858	108889858	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
10450856	Livw4	Liver weight QTL 4	3.8		liver mass (VT:0003402)	liver weight (CMO:0000092)	7	72725037	117725037	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	91	90	59	92	59	6	356	192	11	140	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001007658	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC083742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000007773 ⟹ ENSRNOP00000007773

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	108,495,569 - 108,498,904 (+)	Ensembl
mRatBN7.2 Ensembl	7	106,606,570 - 106,609,746 (+)	Ensembl
Rnor_6.0 Ensembl	7	115,956,276 - 115,959,453 (+)	Ensembl

RefSeq Acc Id:

NM_001007658 ⟹ NP_001007659

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	108,495,554 - 108,498,731 (+)	NCBI
mRatBN7.2	7	106,606,570 - 106,609,747 (+)	NCBI
Rnor_6.0	7	115,956,276 - 115,959,453 (+)	NCBI
Rnor_5.0	7	115,861,665 - 115,864,842 (+)	NCBI
RGSC_v3.4	7	112,835,301 - 112,838,479 (+)	RGD
Celera	7	103,007,718 - 103,010,896 (+)	RGD

Sequence:

show sequence

CTCCGGTCCTCGGAGCTCCCAGGCTCCTAGGCCACCCCGCAGCAGGCACCTGCGCAGCGGGCCC
CTGGGCACCAGGCGCCCGCTGCCAAGATGATGGAGCTGTTGGTGGTGTCGTTATCCTTGGCGCT
CGCCTTCTTTGCGCTGCTGGACGGCTGGTACTTGGTGCGCGTGCCGTGTGCCGTTCTGCGCGCA
CGCTTGCTGCAGCCTCGGGTCCGCGACTTGTTGGCGGAGCAGTTGTATGCCGGCCGGGTGCTGC
CGTCGGACCTGGACCTGCTGCTGCACATGAATAACGCGCGCTACCTGCGCGAGGCGGATGTGGC
ACGCGCCGCGCACCTGACCCGCTGCGGTGTGCTGGGGGCGCTGCGCGACCTGGGCGCGCACACG
GTGCTGGCCGCCTCGTGCGCGCGCTATCGCCGCTCGCTGCGCCTGTTTGAGCCGTTCGAAGTAC
ACACGCGACTGCTAGGCTGGGACGACCGCGCCTTCTACCTGGAGGCGCGCTTTGTCAGCCTTCG
CGATGGTTTCGTGTGCGCCTTGCTGCGTTTCCGGCAGCACGTGCTGGGCACCTCGCCGGATCGA
GTAGTACAGCACTTGTGCAAGCGCAGGGTGGAGCCCCCTGAGCTGCCAGAAGACTTGAAGCATT
GGATCACCTACAATGAGACCAGCAGCCAGCTGCTCCGTGCTGAGAGTGGCCTCAGTGACAGAAA
GGACCAGTGACTGCCAGCCACATCTGCACCCTCCTTGCCTTGCCTGTCAGCCAGTCCATTCCAT
GGAATGGGCCGCCGGGGGCGGGGGGGGGGGTTCACTCCTAACCAGAATGGCCTTGGACAAAGCC
TGGCTTCTTTTACCCGCTTGACACTCCCCTGTGCTTGCCTCATCTTGGCAGCTGGTGGGGTGGA
CGTTGTCGTCCCGGCCTACCTCTGCCTCCTGGGTCCCTATAGCAAGACTGTTCTAGTGTGTCCA
GATGCACAGGATCCTGGAGTAGAAGGGTCAAAAGAATCCAAACTCAGGGCTGCTTGTGGCTATG
CAAGCCAGAGTAGTCCTGGGTGTGGCTGGGGCCTGCAGCTTACTCAGGGACAGTGGGCCATCTG
GAGGGTCACCTTATATCAGGGAAGCTAGGCTAGAACCAGCTCAAGGGCCCTTGAGAACACAGAA
GGGCAAGTGGACGCTGGTTGTTGGCTGCAATTCTGGTGATACCCACCACTTTTAAGAGTGTATA
CCCTGTCTAGGCACCAAGCCTAAGGGGACACTCAGAAATGAGGGCAAGGAGCCCTGGTGTAGGG
GGTCCCATGACTATGCCTAGCACCTGCCCTGTCAGCTCAGGGAGAGGCCAGCTGCTTGAAGCTA
GGAACTGCCTCCTCGATACCTCTCTGGGAACCACACCTGGAGCCAGAGCCAAAAGCTTCATGGA
TGCCCTAACCCCCTCCTGCACCCCACCCTCACCCCCACCCCCACGATGCTATGCTCGCCTTAGT
GCTATCAAGGGGAAAGCTGCAATCCGTTTTATTTAAAGAAAGCACAAGATTAAAAAGAGTTTTC
AAGGCAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001007659	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83742	(Get FASTA)	NCBI Sequence Viewer
	EDM16096	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000007773
	ENSRNOP00000007773.4
GenBank Protein	Q5XIE1	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001007659 ⟸ NM_001007658
- Peptide Label:	precursor
- UniProtKB:	Q5XIE1 (UniProtKB/Swiss-Prot), A6HRX6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MMELLVVSLSLALAFFALLDGWYLVRVPCAVLRARLLQPRVRDLLAEQLYAGRVLPSDLDLLLH MNNARYLREADVARAAHLTRCGVLGALRDLGAHTVLAASCARYRRSLRLFEPFEVHTRLLGWDD RAFYLEARFVSLRDGFVCALLRFRQHVLGTSPDRVVQHLCKRRVEPPELPEDLKHWITYNETSS QLLRAESGLSDRKDQ hide sequence

Ensembl Acc Id:

ENSRNOP00000007773 ⟸ ENSRNOT00000007773

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XIE1-F1-model_v2	AlphaFold	Q5XIE1	1-207	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695373

Promoter ID:

EPDNEW_R5898

Type:

initiation region

Name:

Them6_1

Description:

thioesterase superfamily member 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	115,956,296 - 115,956,356	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359378	AgrOrtholog
BioCyc Gene	G2FUF-33018	BioCyc
Ensembl Genes	ENSRNOG00000005929	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000007773	ENTREZGENE
	ENSRNOT00000007773.7	UniProtKB/Swiss-Prot
Gene3D-CATH	Hotdog Thioesterase	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7191975	IMAGE-MGC_LOAD
InterPro	HotDog_dom_sf	UniProtKB/Swiss-Prot
	THEM6_lcsJ_thioesterase	UniProtKB/Swiss-Prot
KEGG Report	rno:300015	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:94661	IMAGE-MGC_LOAD
NCBI Gene	300015	ENTREZGENE
PANTHER	PROTEIN THEM6	UniProtKB/Swiss-Prot
	PTHR12475	UniProtKB/Swiss-Prot
Pfam	4HBT_2	UniProtKB/Swiss-Prot
PhenoGen	Them6	PhenoGen
RatGTEx	ENSRNOG00000005929	RatGTEx
Superfamily-SCOP	SSF54637	UniProtKB/Swiss-Prot
UniProt	A6HRX6	ENTREZGENE, UniProtKB/TrEMBL
	Q5XIE1	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-10	Them6	thioesterase superfamily member 6	RGD1359378	mesenchymal stem cell protein DSCD75	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	RGD1359378	mesenchymal stem cell protein DSCD75	MGC94661		Symbol updated	1299863	APPROVED
2005-07-29	MGC94661	mesenchymal stem cell protein DSCD75			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message