Advanced Search (OLGA)

Gene: Or4k15 (olfactory receptor family 4 subfamily K member 15) Rattus norvegicus

Analyze

Symbol:

Or4k15

Name:

olfactory receptor family 4 subfamily K member 15

RGD ID:

1334431

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in plasma membrane. Orthologous to human OR4K15 (olfactory receptor family 4 subfamily K member 15); INTERACTS WITH bisphenol A; 2,3,7,8-tetrachlorodibenzodioxine (ortholog); aflatoxin B1 (ortholog).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 1627; olfactory receptor gene Olr1627; olfactory receptor Olr1627; Olr1627

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	25,752,883 - 25,753,857 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	25,604,519 - 25,753,795 (+)	Ensembl				GRCr8
mRatBN7.2	15	23,273,303 - 23,274,277 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	23,270,833 - 23,278,421 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	26,050,576 - 26,051,550 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	27,011,896 - 27,012,870 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	25,259,126 - 25,260,100 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	26,887,767 - 26,888,741 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	26,887,767 - 26,888,741 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	30,813,946 - 30,814,920 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	26,504,566 - 26,505,540 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	23,624,939 - 23,625,913 (+)	NCBI		Celera
RGSC_v3.1	15	26,520,265 - 26,521,240 (+)	NCBI
Cytogenetic Map	15	p14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

aflatoxin B1 (ISO)

bisphenol A (EXP)

CGP 52608 (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IEA)

sensory perception of smell (IEA)

signal transduction (IEA)

Cellular Component

membrane (IEA)

plasma membrane (IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

olfactory receptor activity (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Or4k15
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	25,752,883 - 25,753,857 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	25,604,519 - 25,753,795 (+)	Ensembl				GRCr8
mRatBN7.2	15	23,273,303 - 23,274,277 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	23,270,833 - 23,278,421 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	26,050,576 - 26,051,550 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	27,011,896 - 27,012,870 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	25,259,126 - 25,260,100 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	26,887,767 - 26,888,741 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	26,887,767 - 26,888,741 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	30,813,946 - 30,814,920 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	26,504,566 - 26,505,540 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	23,624,939 - 23,625,913 (+)	NCBI		Celera
RGSC_v3.1	15	26,520,265 - 26,521,240 (+)	NCBI
Cytogenetic Map	15	p14	NCBI

OR4K15
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	19,975,591 - 19,976,565 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	19,975,591 - 19,976,565 (+)	Ensembl			hg38	GRCh38
GRCh37	14	20,443,750 - 20,444,724 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	19,513,518 - 19,514,564 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	14	19,513,517 - 19,514,564	NCBI
Celera	14	309,182 - 310,228 (+)	NCBI		Celera
Cytogenetic Map	14	q11.2	NCBI
HuRef	14	569,630 - 570,676 (+)	NCBI		HuRef
CHM1_1	14	20,444,940 - 20,445,986 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	14,175,053 - 14,176,027 (+)	NCBI		T2T-CHM13v2.0

Or4k15
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	50,364,010 - 50,365,044 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	50,360,643 - 50,366,203 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	50,126,553 - 50,127,587 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	50,123,186 - 50,128,746 (+)	Ensembl			mm10	GRCm38
MGSCv37	14	50,746,228 - 50,747,262 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	49,048,530 - 49,049,504 (+)	NCBI		MGSCv36	mm8
Celera	14	46,357,888 - 46,358,922 (+)	NCBI		Celera
Cytogenetic Map	14	C1	NCBI
cM Map	14	25.97	NCBI

LOC100982052
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	21,484,593 - 21,485,639 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	20,701,083 - 20,702,129 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	850,152 - 851,355 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	18,914,914 - 18,916,121 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	18,914,983 - 18,916,029 (+)	Ensembl			panPan2	panpan1.1

OR4K15
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	131,454 - 132,474 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	131,500 - 132,474 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	34,420 - 35,440 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	221,199 - 222,219 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	221,245 - 222,219 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	176,495 - 177,515 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	268,752 - 269,772 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	316,256 - 317,277 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

LOC100152570
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa10.2	7	133,402,998 - 133,404,035 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OR4K15
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	20,451,132 - 20,453,730 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	20,452,359 - 20,453,387 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666059	26,074,187 - 26,075,333 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Or4k15
34 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	35
Count of miRNA genes:	32
Interacting mature miRNAs:	34
Transcripts:	ENSRNOT00000016674
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641913	Colcr2	Colorectal carcinoma resistance QTL 2	6.57	0.0197	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	15	2315759	47315759	Rat
5684946	Bss98	Bone structure and strength QTL 98	3.9	0.0026	tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	15	1	39411584	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	44836456	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2315759	53331089	Rat
10755503	Bp391	Blood pressure QTL 391	2.37		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	15	22728353	42072050	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	25285835	104695021	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	22336351	52597086	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	25285835	104695021	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	19155762	87086765	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	2785923	47785923	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	32342855	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	14926594	71614418	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	22336351	67336351	Rat
5685002	Bss103	Bone structure and strength QTL 103	2.8		tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	15	16911521	32439851	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	25285835	104695021	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

ectoderm	endocrine system	endoderm	hemolymphoid system	mesenchyme	mesoderm	nervous system	reproductive system	respiratory system
2	2	2	1	2	2	1	3	2

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001000091	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474040	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016674 ⟹ ENSRNOP00000016674

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	15	26,887,767 - 26,888,741 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118231 ⟹ ENSRNOP00000095430

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	23,270,833 - 23,278,421 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000154759 ⟹ ENSRNOP00000099662

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	25,604,519 - 25,753,795 (+)	Ensembl

RefSeq Acc Id:

NM_001000091 ⟹ NP_001000091

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	25,752,883 - 25,753,857 (+)	NCBI
mRatBN7.2	15	23,273,303 - 23,274,277 (+)	NCBI
Rnor_6.0	15	26,887,767 - 26,888,741 (+)	NCBI
Rnor_5.0	15	30,813,946 - 30,814,920 (+)	NCBI
RGSC_v3.4	15	26,504,566 - 26,505,540 (+)	RGD
Celera	15	23,624,939 - 23,625,913 (+)	RGD

Sequence:

show sequence

ATGAATGAAACTAATTACTCTCGGGTGACAGAGTTTGTGCTGTTGGGCCTGTCCAGTTCAAAGG
ATCTCCAGCCTTTCCTGTTTCTCATATTTTCACTGCTGTACTTAGCAATACTGCTGGGTAACTT
CCTCATCATCCTCACAGTGAATTCAGACTCACGACTTCACACTCCCATGTACTTTCTGCTTGCA
AACTTATCTTTTATAGATATATGTGTAGCTTCTTTTGCTACTCCCAAAATGCTTGCTGACTTTC
TGGTGGAAAGAAAAACTATATCTTTTGATGCCTGTTTGGCACAGATTTTTTTTGTTCATCTCTT
TACTGGCGGTGAGATGGTCCTTCTTGTGTCCATGGCCTATGATCGCTATGTGGCAATATGCAAG
CCCCTCCATTACATGACGATCATGAGTCGCCGTGTGTGTATCATTCTAGTTATCATCTCCTGGT
TTGTGGGTTTCATCCACACAACTAGCCAGTTGGCATTCACTGTTAACTTGCCATTTTGTGGTCC
TAACCAGGTGGACAGTTTTTTCTGTGATCTCCCACTGGTGACCAAGCTAGCTTGCATAGACACT
TATGTTGTCAGCTTGCTAATAGTTGCAGATAGTGGATTTCTCTCCCTGAGTTCATTCCTCCTCT
TGGTCGTCTCCTACACTGTGATTCTCATTACTGTTAGGAATCGTTCCTCTGCTAGCATGGCCAA
GGCCAGATCCACCCTAACTGCCCACATCACTGTAGTCACATTATTCTTTGGACCATGCATCTTC
ATCTATGTGTGGCCCTTTAGCAGCTACTCAGTTGACAAAGTCCTTGCTGTGTTCTACACCATCT
TCACACCCATTTTAAACCCAGTTATCTACACGCTGAGAAACAAAGAGGTGAAAGCAGCTATGTC
AAAGCTGAGGAGTCGCTATCTGAAACCTGGACAGGTTTCTGCATTGATAAGAAATGTTCTTTTG
CTGGAAACAAAATAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001000091	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL88397	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000099662
	ENSRNOP00000099662.1

RefSeq Acc Id:

NP_001000091 ⟸ NM_001000091

- UniProtKB:

A0A8I6AQJ4 (UniProtKB/TrEMBL), A6KE92 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNETNYSRVTEFVLLGLSSSKDLQPFLFLIFSLLYLAILLGNFLIILTVNSDSRLHTPMYFLLA
NLSFIDICVASFATPKMLADFLVERKTISFDACLAQIFFVHLFTGGEMVLLVSMAYDRYVAICK
PLHYMTIMSRRVCIILVIISWFVGFIHTTSQLAFTVNLPFCGPNQVDSFFCDLPLVTKLACIDT
YVVSLLIVADSGFLSLSSFLLLVVSYTVILITVRNRSSASMAKARSTLTAHITVVTLFFGPCIF
IYVWPFSSYSVDKVLAVFYTIFTPILNPVIYTLRNKEVKAAMSKLRSRYLKPGQVSALIRNVLL
LETK

hide sequence

Ensembl Acc Id:

ENSRNOP00000016674 ⟸ ENSRNOT00000016674

Ensembl Acc Id:

ENSRNOP00000095430 ⟸ ENSRNOT00000118231

Ensembl Acc Id:

ENSRNOP00000099662 ⟸ ENSRNOT00000154759

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZSE2-F1-model_v2	AlphaFold	D3ZSE2	1-324	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1334431	AgrOrtholog
BioCyc Gene	G2FUF-14093	BioCyc
Ensembl Genes	ENSRNOG00000012510	Ensembl
	ENSRNOG00000064001	Ensembl
	ENSRNOG00000075034	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000154759	ENTREZGENE
	ENSRNOT00000154759.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
	Olfactory_Receptors	UniProtKB/TrEMBL
KEGG Report	rno:290003	UniProtKB/TrEMBL
NCBI Gene	290003	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or4k15	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000012510	RatGTEx
	ENSRNOG00000064001	RatGTEx
	ENSRNOG00000075034	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0A8I6AQJ4	ENTREZGENE
	A0ABK0L6R8_RAT	UniProtKB/TrEMBL
	A6KE92	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or4k15	olfactory receptor family 4 subfamily K member 15	Olr1627	olfactory receptor 1627	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr1627	olfactory receptor 1627	Olr1627_predicted	olfactory receptor 1627 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr1627_predicted	olfactory receptor 1627 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Mammalian Phenotype