Advanced Search (OLGA)

Gene: Or4b1d (olfactory receptor family 4 subfamily B member 1D) Rattus norvegicus

Analyze

No known orthologs.

Symbol:

Or4b1d

Name:

olfactory receptor family 4 subfamily B member 1D

RGD ID:

1334287

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in membrane. Predicted to be active in plasma membrane; INTERACTS WITH ammonium chloride; candesartan; Muraglitazar.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

odorant receptor; olfactory receptor 737; olfactory receptor gene Olr737; olfactory receptor Olr737; Olr737; tpcr09

RGD Orthologs

Alliance Orthologs

More Info

homologs ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Other homologs ²				less info ...
Homo sapiens (human):	OR4B1 (olfactory receptor family 4 subfamily B member 1)	HGNC	Ensembl, HomoloGene, OrthoDB
Homo sapiens (human):	SLC12A2 (solute carrier family 12 member 2)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Or4b1d (olfactory receptor family 4 subfamily B member 1D)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	or63a2	Alliance	DIOPT (Ensembl Compara\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	or30a2	Alliance	DIOPT (Ensembl Compara\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	or64j1b	Alliance	DIOPT (Ensembl Compara\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	96,663,710 - 96,664,636 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	96,663,710 - 96,664,636 (-)	Ensembl				GRCr8
mRatBN7.2	3	76,207,843 - 76,208,769 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	76,207,843 - 76,208,769 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	79,699,164 - 79,700,090 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	88,297,697 - 88,298,623 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	86,141,925 - 86,142,851 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	3	94,497,173 - 94,498,099 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	3	101,431,403 - 101,432,329 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	3	93,349,164 - 93,350,090 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	3	74,630,772 - 74,631,698 (-)	NCBI		F344_StmMcwi
Rnor_6.0	3	79,050,177 - 79,051,103 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	79,050,177 - 79,051,103 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	85,764,826 - 85,765,752 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	74,612,307 - 74,613,233 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	75,450,043 - 75,450,969 (-)	NCBI		Celera
RGSC_v3.1	3	74,508,678 - 74,509,605 (-)	NCBI
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

ammonium chloride (EXP)

candesartan (EXP)

Muraglitazar (EXP)

Tesaglitazar (EXP)

troglitazone (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IEA)

sensory perception of smell (IEA)

signal transduction (IEA)

Cellular Component

membrane (IEA)

plasma membrane (IBA,IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

olfactory receptor activity (IBA,IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9119360	PMID:11014824

Genomics

Variants

Variants in Or4b1d
8 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	73592611	110333156	Rat
1358293	Bw38	Body weight QTL 38	6	0.0000031	body mass (VT:0001259)	body weight (CMO:0000012)	3	74364268	119364268	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	96509147	141509147	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	136118980	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	85062224	136118980	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	85062224	136118980	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	81425008	141509147	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	70845569	136091483	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	3	93829559	138829559	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	96509147	141509147	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	58925062	103925062	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	70311536	115311536	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	81541464	126563126	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	90755164	141509147	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

appendage	ectoderm	endoderm	mesenchyme	nervous system	renal system	reproductive system	respiratory system
1	9	1	3	9	2	13	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001000616	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF271050	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X89698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000088256 ⟹ ENSRNOP00000071069

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	96,663,710 - 96,664,636 (-)	Ensembl
mRatBN7.2 Ensembl	3	76,207,843 - 76,208,769 (-)	Ensembl
Rnor_6.0 Ensembl	3	79,050,177 - 79,051,103 (-)	Ensembl

RefSeq Acc Id:

NM_001000616 ⟹ NP_001000616

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	96,663,710 - 96,664,636 (-)	NCBI
mRatBN7.2	3	76,207,843 - 76,208,769 (-)	NCBI
Dahl_SR_JrHsd	3	94,497,173 - 94,498,099 (-)	NCBI
Lyon_Normotensive	3	101,431,403 - 101,432,329 (-)	NCBI
Lyon_Hypertensive	3	93,349,164 - 93,350,090 (-)	NCBI
F344_StmMcwi	3	74,630,772 - 74,631,698 (-)	NCBI
Rnor_6.0	3	79,050,177 - 79,051,103 (-)	NCBI
Rnor_5.0	3	85,764,826 - 85,765,752 (-)	NCBI
RGSC_v3.4	3	74,612,307 - 74,613,233 (-)	RGD
Celera	3	75,450,043 - 75,450,969 (-)	RGD

Sequence:

show sequence

ATGGCCAATGTAAATGTGACTGAGTTGATCATCACTGGCCTTTTCCAGGACCTAGAGGTGCAGA
AGGTGTGCTTTGTGTTGTTTCTTCCTGTGTATCTGGCCACTGTGCTGGGCAATGGCCTCATTGT
TGTGACAGTCAACATCAGCAAGAGTCTGTATTCCCCCATGTATTTCTTCCTTAGCTACCTATCC
TTGGTAGAGATCCTCTACTCCTCTACTGTTGTCCCTAAGTTCATCACTGATTTACTTCACAAGA
TTAAAACCATCTCTCTGAAGGGCTGCCTGGCTCAGATTTTCTTCTTCCACTTCTTTGGGGTCAC
TGAGATACTTTTGCTTACAGTGATGGCTTATGACCGTTATGTGGCTATCTGCAAACCTCTTTAC
TATACAACTATTATGAGTAGGCCCATATGTCACCGCCTGGTGGCTGGTTCCTGGGTGGGGGGAT
TTTTTCATTCTATTATTCAGATTTTCATCACTATCCCTTTGCCTTTCTGTGGTCCCAATATTAT
TGACCACTACTTCTGTGACCTCCATCCCTTATTCAAGTTGGCCTGCACTGACACTTTTGTGGTA
GGGGTAATTATGTTTGTTAACAGTGGATTATTTTCTGTATTTTCCTTCCTTTTCTTGGTGTCTT
CTTACATTGTTATCCTATATAACTTGAGGAATCACTCTGCTGAGGGGAGGCGCAAGGCTCTATC
TACCTGTGCATCTCACATCATGGTGGTTGTCTTGTTCTTCGGACCTGCCATCTTCCTCTACTTG
AGACCTGCTTCCACTTACACTGAAGACAAGCTTGTGGCTGTGTTCTACACGGTTATTACCCCCA
TGATGAACCCCATCATCTACACACTCAGAAATGCAGAGGTGAAAAATGCTGTGAGGAGGTTGTG
GGGCAAAAAAGTGAGTTCAAGTCTGGAATAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001000616	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG21323	(Get FASTA)	NCBI Sequence Viewer
	CAA61845	(Get FASTA)	NCBI Sequence Viewer
	EDL79461	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071069
	ENSRNOP00000071069.1

RefSeq Acc Id:

NP_001000616 ⟸ NM_001000616

- UniProtKB:

A0A0G2JZJ2 (UniProtKB/TrEMBL), A6HN60 (UniProtKB/TrEMBL), Q9ERX1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MANVNVTELIITGLFQDLEVQKVCFVLFLPVYLATVLGNGLIVVTVNISKSLYSPMYFFLSYLS
LVEILYSSTVVPKFITDLLHKIKTISLKGCLAQIFFFHFFGVTEILLLTVMAYDRYVAICKPLY
YTTIMSRPICHRLVAGSWVGGFFHSIIQIFITIPLPFCGPNIIDHYFCDLHPLFKLACTDTFVV
GVIMFVNSGLFSVFSFLFLVSSYIVILYNLRNHSAEGRRKALSTCASHIMVVVLFFGPAIFLYL
RPASTYTEDKLVAVFYTVITPMMNPIIYTLRNAEVKNAVRRLWGKKVSSSLE

hide sequence

Ensembl Acc Id:

ENSRNOP00000071069 ⟸ ENSRNOT00000088256

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2JZJ2-F1-model_v2	AlphaFold	A0A0G2JZJ2	1-308	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1334287	AgrOrtholog
BioCyc Gene	G2FUF-48788	BioCyc
Ensembl Genes	ENSRNOG00000052463	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000088256	ENTREZGENE
	ENSRNOT00000088256.3	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
	Olfactory_Receptors	UniProtKB/TrEMBL
KEGG Report	rno:404808	UniProtKB/TrEMBL
NCBI Gene	404808	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or4b1d	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000052463	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0A0G2JZJ2	ENTREZGENE, UniProtKB/TrEMBL
	A6HN60	ENTREZGENE, UniProtKB/TrEMBL
	Q9ERX1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or4b1d	olfactory receptor family 4 subfamily B member 1D	Olr737	olfactory receptor 737	Symbol and Name Changed	1299863	APPROVED
2005-12-06	Olr737	olfactory receptor 737	Olr737_predicted	olfactory receptor 737 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-02-04	Olr737_predicted	olfactory receptor 737 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Mammalian Phenotype