Advanced Search (OLGA)

Gene: Or2t6 (olfactory receptor family 2 subfamily T member 6) Rattus norvegicus

Analyze

Symbol:

Or2t6

Name:

olfactory receptor family 2 subfamily T member 6

RGD ID:

1334102

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in membrane. Predicted to be active in plasma membrane. Orthologous to human OR2T6 (olfactory receptor family 2 subfamily T member 6); INTERACTS WITH cadmium dichloride; copper atom; copper(0).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 1607; olfactory receptor gene Olr1607; olfactory receptor Olr1607; Olr1607; ratchr15-12608540-12609487_ORF

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OR2T6 (olfactory receptor family 2 subfamily T member 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Or2t6 (olfactory receptor family 2 subfamily T member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100973282 (olfactory receptor 2T6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OR2T6 (olfactory receptor family 2 subfamily T member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101974064 (olfactory receptor 2T6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OR2T6 (olfactory receptor family 2 subfamily T member 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	OR2T6 (olfactory receptor family 2 subfamily T member 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	OR2T6 (olfactory receptor family 2 subfamily T member 6)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Or2t6 (olfactory receptor family 2 subfamily T member 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Or2t6 (olfactory receptor family 2 subfamily T member 6)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-37	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-36	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-38	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-35	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-39	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	or13aq1	Alliance	DIOPT (Hieranoid\|InParanoid)
Xenopus tropicalis (tropical clawed frog):	or13aq3	Alliance	DIOPT (Hieranoid\|InParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	13,493,693 - 13,494,640 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	13,493,693 - 13,494,640 (+)	Ensembl				GRCr8
mRatBN7.2	15	11,063,192 - 11,064,139 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	11,052,916 - 11,068,695 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	13,189,762 - 13,190,709 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	14,141,918 - 14,142,865 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	12,403,055 - 12,404,002 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	12,363,377 - 12,364,324 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	12,363,377 - 12,364,324 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	16,394,649 - 16,395,596 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	12,608,540 - 12,609,487 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	11,070,389 - 11,071,336 (+)	NCBI		Celera
RGSC_v3.1	15	12,608,539 - 12,609,487 (+)	NCBI
Cytogenetic Map	15	p16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

gastrointestinal stromal tumor (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (ISO)

cadmium dichloride (EXP)

copper atom (EXP)

copper(0) (EXP)

folic acid (ISO)

resveratrol (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IEA)

sensory perception of smell (IEA)

signal transduction (IEA)

Cellular Component

membrane (IEA)

plasma membrane (IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

olfactory receptor activity (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Or2t6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	15	13,493,693 - 13,494,640 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	15	13,493,693 - 13,494,640 (+)	Ensembl				GRCr8
mRatBN7.2	15	11,063,192 - 11,064,139 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	11,052,916 - 11,068,695 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	15	13,189,762 - 13,190,709 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	15	14,141,918 - 14,142,865 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	15	12,403,055 - 12,404,002 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	15	12,363,377 - 12,364,324 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	12,363,377 - 12,364,324 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	15	16,394,649 - 16,395,596 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	15	12,608,540 - 12,609,487 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	15	11,070,389 - 11,071,336 (+)	NCBI		Celera
RGSC_v3.1	15	12,608,539 - 12,609,487 (+)	NCBI
Cytogenetic Map	15	p16	NCBI

OR2T6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	248,375,746 - 248,391,811 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	248,375,746 - 248,391,811 (+)	Ensembl			hg38	GRCh38
GRCh37	1	248,539,047 - 248,555,112 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	246,617,533 - 246,618,459 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	244,876,950 - 244,877,877	NCBI
Celera	1	221,835,150 - 221,836,076 (+)	NCBI		Celera
Cytogenetic Map	1	q44	NCBI
HuRef	1	218,934,668 - 218,935,594 (+)	NCBI		HuRef
CHM1_1	1	249,823,108 - 249,824,034 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	247,802,189 - 247,816,830 (+)	NCBI		T2T-CHM13v2.0

Or2t6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	8,293,683 - 8,294,633 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	8,282,925 - 8,298,025 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	14,175,130 - 14,176,080 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	14,171,738 - 14,186,838 (-)	Ensembl			mm10	GRCm38
MGSCv37	14	15,007,644 - 15,008,594 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	12,968,397 - 12,969,347 (-)	NCBI		MGSCv36	mm8
Celera	14	9,833,549 - 9,834,499 (-)	NCBI		Celera
Cytogenetic Map	14	A1	NCBI
cM Map	14	7.08	NCBI

LOC100973282
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	596,622 - 611,547 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	872,561 - 887,607 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	224,087,513 - 224,088,439 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	229,534,065 - 229,534,991 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2

OR2T6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	14	2,595,008 - 2,595,967 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	14	2,595,008 - 2,595,934 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	14	2,245,174 - 2,246,133 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	14	2,327,775 - 2,328,734 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	14	2,327,775 - 2,328,701 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	14	2,491,429 - 2,492,388 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	14	2,292,009 - 2,292,968 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	14	2,270,826 - 2,271,785 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

LOC101974064
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	89,488,517 - 89,489,532 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936878	172,265 - 173,215 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936878	172,265 - 182,364 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OR2T6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	85,312,077 - 85,314,868 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666055	87,782,814 - 87,784,218 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Or2t6
3 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	31
Count of miRNA genes:	29
Interacting mature miRNAs:	30
Transcripts:	ENSRNOT00000008805
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1641913	Colcr2	Colorectal carcinoma resistance QTL 2	6.57	0.0197	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	15	2315759	47315759	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	2785923	47785923	Rat
5684946	Bss98	Bone structure and strength QTL 98	3.9	0.0026	tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	15	1	39411584	Rat
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	32342855	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	44836456	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2315759	53331089	Rat
1300142	Bp191	Blood pressure QTL 191	3.14		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	15	1	15177511	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

ectoderm	endoderm	nervous system	reproductive system	respiratory system
1	1	1	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001000534	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008805 ⟹ ENSRNOP00000008805

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	15	12,363,377 - 12,364,324 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094188 ⟹ ENSRNOP00000086205

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	11,052,986 - 11,068,695 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094430 ⟹ ENSRNOP00000079397

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	11,054,188 - 11,068,695 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112485 ⟹ ENSRNOP00000096152

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	11,052,916 - 11,066,645 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000163083 ⟹ ENSRNOP00000098907

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	15	13,493,693 - 13,494,640 (+)	Ensembl

RefSeq Acc Id:

NM_001000534 ⟹ NP_001000534

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	15	13,493,693 - 13,494,640 (+)	NCBI
mRatBN7.2	15	11,063,192 - 11,064,139 (+)	NCBI
Rnor_6.0	15	12,363,377 - 12,364,324 (+)	NCBI
Rnor_5.0	15	16,394,649 - 16,395,596 (+)	NCBI
RGSC_v3.4	15	12,608,540 - 12,609,487 (+)	RGD
Celera	15	11,070,389 - 11,071,336 (+)	RGD

Sequence:

show sequence

ATGGATGGAAACAAAACCATCCCCAGTGACTTCACCTTTGTGGGGCTCTTTACTCACAAAGCCT
CGGGATTCCTCTTCAGTGTTATTTGTGCCGTGTTCTTCCTGGCCTTAGTGTCCAATGGAGTCAT
GATCTTTCTCATTCACATAGACCCTCATCTTCACACCCCCATGTATTTCCTCCTCAGCCACCTC
TCCATCATCGACATGATGTATATTTCCACTATTGTACCTAAGATATTGATTGATTACATTGTAG
GCAAAGGGATCATCTCTTTCGCTGCCTGTACAGCCCAGTACTTTCTATACATGGGCTTTGTAGG
GGCCGAGTTCTTCCTGCTGGGACTTATGGCCTATGACCGCTATGTGGCCATCTGCAATCCTCTC
CGTTATCCTGTCCTCATGAGTCGGAGGGTGTGCTGGTTTATTTTGGCCAGCTCTTGGTTCGGTG
GGGCTTTGGACAGTTTCCTCCTCACACCCATCACCATGAGTCTCCCGTTCTGTGCATCCCACAA
GATCAACCACTTTTTCTGCGAGGCTCCTACGATGCTGAGGCTGGCCTGTGGTGACAAAGCCATA
TATGAAATGGTGATGTACATCTGCTGTGTGGTGATGCTGTTGGTCCCCTTCTCTGTGGTGATCA
CATCCTATGCCCAGATACTGGTCACAGTACATCAGATAAAGTCTGAAGAAGGGAGGAAGAAGGC
CTTTGCCACCTGCTCATCACATGTGATTGTGGTAACATTGTTTTATGGGGCTGCTTTGTACACC
TATATGCTTCCCCAAGCCTATCACACCCCACTCAAGGACAAAATCTTCTCAGCCTTTTATACCA
TCCTCACCCCCTTGCTCAACCCTGTTATTTACAGTCTGAGGAACAGAGATGTGGCAGGGGCTTT
GAAGAGGGTGATAGCAAGACATAGAGGGACCTGTGGTATGGAAAGGAATTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001000534	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL94115	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000098907
	ENSRNOP00000098907.1

RefSeq Acc Id:

NP_001000534 ⟸ NM_001000534

- UniProtKB:

D3ZDH5 (UniProtKB/TrEMBL), A6K068 (UniProtKB/TrEMBL), A0A8I6ANS0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDGNKTIPSDFTFVGLFTHKASGFLFSVICAVFFLALVSNGVMIFLIHIDPHLHTPMYFLLSHL
SIIDMMYISTIVPKILIDYIVGKGIISFAACTAQYFLYMGFVGAEFFLLGLMAYDRYVAICNPL
RYPVLMSRRVCWFILASSWFGGALDSFLLTPITMSLPFCASHKINHFFCEAPTMLRLACGDKAI
YEMVMYICCVVMLLVPFSVVITSYAQILVTVHQIKSEEGRKKAFATCSSHVIVVTLFYGAALYT
YMLPQAYHTPLKDKIFSAFYTILTPLLNPVIYSLRNRDVAGALKRVIARHRGTCGMERN

hide sequence

Ensembl Acc Id:

ENSRNOP00000008805 ⟸ ENSRNOT00000008805

Ensembl Acc Id:

ENSRNOP00000086205 ⟸ ENSRNOT00000094188

Ensembl Acc Id:

ENSRNOP00000096152 ⟸ ENSRNOT00000112485

Ensembl Acc Id:

ENSRNOP00000079397 ⟸ ENSRNOT00000094430

Ensembl Acc Id:

ENSRNOP00000098907 ⟸ ENSRNOT00000163083

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZDH5-F1-model_v2	AlphaFold	D3ZDH5	1-315	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1334102	AgrOrtholog
BioCyc Gene	G2FUF-14382	BioCyc
Ensembl Genes	ENSRNOG00000006746	Ensembl
	ENSRNOG00000063635	Ensembl
	ENSRNOG00000084296	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000163083	ENTREZGENE
	ENSRNOT00000163083.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
KEGG Report	rno:364275	UniProtKB/TrEMBL
NCBI Gene	364275	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or2t6	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000006746	RatGTEx
	ENSRNOG00000063635	RatGTEx
	ENSRNOG00000084296	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0A8I6ANS0	ENTREZGENE
	A6K068	ENTREZGENE, UniProtKB/TrEMBL
	D3ZDH5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or2t6	olfactory receptor family 2 subfamily T member 6	Olr1607	olfactory receptor 1607	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr1607	olfactory receptor 1607	Olr1607_predicted	olfactory receptor 1607 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr1607_predicted	olfactory receptor 1607 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype