Advanced Search (OLGA)

Gene: Or5v1b (olfactory receptor family 5 subfamily V member 1B) Rattus norvegicus

Analyze

Symbol:

Or5v1b

Name:

olfactory receptor family 5 subfamily V member 1B

RGD ID:

1334062

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in membrane. Predicted to be active in plasma membrane. Orthologous to human OR5V1 (olfactory receptor family 5 subfamily V member 1); INTERACTS WITH bisphenol A; aflatoxin B1 (ortholog); arsane (ortholog).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

MOR249-2; olfactory receptor 1730; olfactory receptor 30; Olr1730; Or30; ratchr20-1246310-1247263_ORF

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OR5V1 (olfactory receptor family 5 subfamily V member 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Or5v1b (olfactory receptor family 5 subfamily V member 1B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100972682 (olfactory receptor 5V1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OR13L2 (olfactory receptor family 13 subfamily L member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LOC100152520 (olfactory receptor 5V1-like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103221889 (olfactory receptor 5V1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	OR5V1 (olfactory receptor family 5 subfamily V member 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	OR5V1 (olfactory receptor family 5 subfamily V member 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Or5v1 (olfactory receptor family 5 subfamily V member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Or5v1 (olfactory receptor family 5 subfamily V member 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Or5v1b (olfactory receptor family 5 subfamily V member 1B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Or5v1b (olfactory receptor family 5 subfamily V member 1B)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-37	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-36	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-38	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-35	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-39	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	or5dm1	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	LOC100491436	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	1,163,321 - 1,164,274 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	1,163,321 - 1,164,274 (+)	Ensembl				GRCr8
mRatBN7.2	20	1,158,073 - 1,159,026 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	1,151,540 - 1,159,222 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	1,193,522 - 1,194,475 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	1,197,008 - 1,197,961 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	1,153,628 - 1,154,581 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	1,647,469 - 1,648,422 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	1,647,441 - 1,648,449 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	3,692,456 - 3,693,409 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	1,246,310 - 1,247,263 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	1,891,645 - 1,892,598 (+)	NCBI		Celera
RGSC_v3.1	20	1,246,309 - 1,247,258 (+)	NCBI
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

aflatoxin B1 (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

crocidolite asbestos (ISO)

sodium arsenite (ISO)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IBA,IEA)

G protein-coupled receptor signaling pathway (IEA,TAS)

sensory perception of smell (IEA)

signal transduction (IEA)

Cellular Component

membrane (IEA)

plasma membrane (IBA,IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

olfactory receptor activity (IBA,IEA,TAS)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	The genomic sequence and comparative analysis of the rat major histocompatibility complex.	Hurt P, etal., Genome Res 2004 Apr;14(4):631-9.
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Or5v1b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	1,163,321 - 1,164,274 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	1,163,321 - 1,164,274 (+)	Ensembl				GRCr8
mRatBN7.2	20	1,158,073 - 1,159,026 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	1,151,540 - 1,159,222 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	1,193,522 - 1,194,475 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	1,197,008 - 1,197,961 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	1,153,628 - 1,154,581 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	1,647,469 - 1,648,422 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	1,647,441 - 1,648,449 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	3,692,456 - 3,693,409 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	1,246,310 - 1,247,263 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	1,891,645 - 1,892,598 (+)	NCBI		Celera
RGSC_v3.1	20	1,246,309 - 1,247,258 (+)	NCBI
Cytogenetic Map	20	p12	NCBI

OR5V1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	29,353,749 - 29,368,865 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	29,353,749 - 29,431,967 (-)	Ensembl			hg38	GRCh38
GRCh37	6	29,321,526 - 29,336,642 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	29,430,986 - 29,432,033 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	29,430,985 - 29,432,033	NCBI
Celera	6	30,929,186 - 30,930,233 (-)	NCBI		Celera
Cytogenetic Map	6	p22.1	NCBI
HuRef	6	29,130,619 - 29,131,666 (-)	NCBI		HuRef
CHM1_1	6	29,325,270 - 29,326,317 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	29,228,525 - 29,243,652 (-)	NCBI		T2T-CHM13v2.0

Or5v1b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	37,815,851 - 37,844,816 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	37,818,921 - 37,843,340 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	37,525,753 - 37,537,652 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	37,508,030 - 37,532,449 (+)	Ensembl			mm10	GRCm38
MGSCv37	17	37,666,902 - 37,667,942 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	37,138,032 - 37,138,985 (+)	NCBI		MGSCv36	mm8
Celera	17	40,971,961 - 40,973,001 (+)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	19.16	NCBI

LOC100972682
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	43,986,009 - 44,000,824 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	39,950,375 - 39,965,190 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	29,173,223 - 29,174,264 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	29,831,339 - 29,832,380 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	29,831,339 - 29,832,304 (-)	Ensembl			panPan2	panpan1.1

OR13L2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	57,996,386 - 57,997,345 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	57,996,386 - 57,997,345 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	57,464,971 - 57,465,930 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	58,999,636 - 59,000,595 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	58,999,636 - 59,000,595 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	57,873,332 - 57,874,291 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	57,926,669 - 57,927,628 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	58,653,284 - 58,654,243 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

LOC100152520
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa10.2	7	25,794,642 - 25,795,595 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103221889
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	43,228,075 - 43,231,547 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	43,228,604 - 43,229,566 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666044	29,006,036 - 29,009,081 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Or5v1b
4 total Variants

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61474	Eae1	Experimental allergic encephalomyelitis QTL 1	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	20	1	6693431	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	1	26925056	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1	33724594	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26128279	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600300	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24164241	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	1	34066551	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29193376	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	6693431	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	1	27341128	Rat
724519	Bp144	Blood pressure QTL 144		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	20	1	3629303	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29193376	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29193376	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29193376	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29193376	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1	14100378	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578510	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600300	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
23	17	8	2	10	2	1	31	15	17	14	26	6

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001000279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000986 ⟹ ENSRNOP00000000986

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	964,172 - 965,125 (-)	Ensembl
Rnor_6.0 Ensembl	20	1,647,441 - 1,648,449 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108245 ⟹ ENSRNOP00000085660

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	1,163,321 - 1,164,274 (+)	Ensembl
mRatBN7.2 Ensembl	20	1,151,540 - 1,159,222 (+)	Ensembl

RefSeq Acc Id:

NM_001000279 ⟹ NP_001000279

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	1,163,321 - 1,164,274 (+)	NCBI
mRatBN7.2	20	1,158,073 - 1,159,026 (+)	NCBI
Rnor_6.0	20	1,647,469 - 1,648,422 (+)	NCBI
Rnor_5.0	20	3,692,456 - 3,693,409 (+)	NCBI
RGSC_v3.4	20	1,246,310 - 1,247,263 (+)	RGD
Celera	20	1,891,645 - 1,892,598 (+)	RGD

Sequence:

show sequence

ATGGAAGGAAAGAATCGAACAACTCCATCTGAATTCATCATCTTGGGGTTCTCCCACCTAAATG
AATTGCAGTTTTTACTTTTCACCATCTTCTTTCTGACCTACATATGTACTTTAGGAGGCAATGT
TTTTATCATTGTGGTGACCATGGCTGATTCCCACCTACATACACCCATGTATTATTTTCTACGA
AATCTTGCCTTTATTGACATCTGCTACACTACCACTAATGTCCCCCAGATGATGGTGCATCTTC
TGTCAGAGAAGAAAACCATCTCCTATGGAGGTTGTGTGACCCAGCTCTTTGCTTTCATTTTCTT
TGTTGGCTCAGAGTGCCTCCTCCTGGCAGCAATGGCATATGACAGATACATTGCCATCTGCAAG
CCTTTAAGATACTCATTTATTATGAACAAGGCCCTGTGTAGCTGGTTAGCAGCTTCATGCTGGA
CAGGTGGGTTTCTCAACTCCATGCTGCACACAGTAATGACCTTCCACCTGCCCTTCTGTGGTAA
CAATCAGATCAATTATTTCTTCTGTGACATACCTCCTTTGCTGATCTTGTCTTGTGGTGATACT
GCCCTTAATGAACTGGCTTTGCTATCCATTGGGATCGTCATAGGTTGGACTCCTTTCCTGTGCA
TCATCCTTTCCTACCTTTACATCATCTCCACCATCCTGAGGATCCGCTCCTCTCAGGGGAGGCA
CAAAGCCTTTTCCACCTGTGCCTCCCACCTGCTCATTGTTATTCTCTATTATGGCAGTGCCATC
TTCACATATGTGAGGCCCATATCTTCTTACTCACTAGAGAAAGACAGGTTGATCTCAGTGCTGT
ATAGTGTTGTGACACCCATGATGAATCCTGTAATTTATACACTGAGGAATAAGGACATCAAAGA
GGCTGTGAAGGCCATAGGGAGAAAGTGGCAGCCACCAGTTTTCTCTTCTGATATGTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001000279	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000085660
	ENSRNOP00000085660.1

RefSeq Acc Id:

NP_001000279 ⟸ NM_001000279

- UniProtKB:

A0A8I6A2T4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEGKNRTTPSEFIILGFSHLNELQFLLFTIFFLTYICTLGGNVFIIVVTMADSHLHTPMYYFLR
NLAFIDICYTTTNVPQMMVHLLSEKKTISYGGCVTQLFAFIFFVGSECLLLAAMAYDRYIAICK
PLRYSFIMNKALCSWLAASCWTGGFLNSMLHTVMTFHLPFCGNNQINYFFCDIPPLLILSCGDT
ALNELALLSIGIVIGWTPFLCIILSYLYIISTILRIRSSQGRHKAFSTCASHLLIVILYYGSAI
FTYVRPISSYSLEKDRLISVLYSVVTPMMNPVIYTLRNKDIKEAVKAIGRKWQPPVFSSDM

hide sequence

Ensembl Acc Id:

ENSRNOP00000000986 ⟸ ENSRNOT00000000986

Ensembl Acc Id:

ENSRNOP00000085660 ⟸ ENSRNOT00000108245

Protein Domains

G-protein coupled receptors family 1 profile

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1334062	AgrOrtholog
BioCyc Gene	G2FUF-5018	BioCyc
Ensembl Genes	ENSRNOG00000000759	Ensembl
	ENSRNOG00000065028	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000108245	ENTREZGENE
	ENSRNOT00000108245.2	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
	Olfactory_GPCR	UniProtKB/TrEMBL
KEGG Report	rno:294187	UniProtKB/TrEMBL
NCBI Gene	294187	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or5v1b	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000000759	RatGTEx
	ENSRNOG00000065028	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0A8I6A2T4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or5v1b	olfactory receptor family 5 subfamily V member 1B	Olr1730	olfactory receptor 1730	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr1730	olfactory receptor 1730	Olr1730_predicted	olfactory receptor 1730 (predicted)	'predicted' is removed	2292626	APPROVED
2005-03-02	Olr1730_predicted	olfactory receptor 1730 (predicted)	Or30	olfactory receptor 30	Symbol and Name status set to approved	737654	APPROVED
2005-02-14	Or30	olfactory receptor 30			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-02-04	Olr1730_predicted	olfactory receptor 1730 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Mammalian Phenotype