Advanced Search (OLGA)

Gene: Or7c70 (olfactory receptor family 7 subfamily C member 70) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Or7c70

Name:

olfactory receptor family 7 subfamily C member 70

RGD ID:

1334014

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in signal transduction. Predicted to be active in plasma membrane. Orthologous to several human genes including OR7C2 (olfactory receptor family 7 subfamily C member 2); INTERACTS WITH 1,2-dimethylhydrazine; bisphenol A; furan.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 1086; olfactory receptor gene Olr1086; olfactory receptor Olr1086; Olr1086

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	11,461,214 - 11,468,390 (+)	NCBI		GRCr8
mRatBN7.2	7	10,810,624 - 10,811,586 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	10,799,830 - 10,813,059 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	13,626,580 - 13,627,542 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	15,504,023 - 15,504,985 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	13,387,098 - 13,388,060 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	13,698,647 - 13,699,609 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	13,698,647 - 13,699,609 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	13,862,639 - 13,863,601 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	12,362,119 - 12,363,081 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	12,362,118 - 12,363,081 (+)	NCBI
Celera	7	8,927,720 - 8,928,682 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or7c70	Rat	1,2-dimethylhydrazine	multiple interactions	EXP		6480464	[APC protein affects the susceptibility to 1,2-Dimethylhydrazine] which results in decreased expression of OR7C70 mRNA	CTD	PMID:27840820
Or7c70	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1344773	6480464	Benzo(a)pyrene affects the methylation of OR7C2 promoter	CTD	PMID:27901495
Or7c70	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of OR7C2 mRNA	CTD	PMID:25181051
Or7c70	Rat	camptothecin	decreases response to substance	ISO	RGD:1344773	6480464	OR7C2 mRNA results in decreased susceptibility to Camptothecin	CTD	PMID:25269479
Or7c70	Rat	crocidolite asbestos	affects expression	ISO	RGD:1344773	6480464	Asbestos, Crocidolite affects the expression of OR7C2 mRNA	CTD	PMID:17331233
Or7c70	Rat	furan	increases methylation	EXP		6480464	furan results in increased methylation of OR7C70 gene	CTD	PMID:22079235

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or7c70	Rat	detection of chemical stimulus involved in sensory perception of smell		IEA	RGD:5131483	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or7c70	Rat	detection of chemical stimulus involved in sensory perception of smell	involved_in	IEA	GO:0004984	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Or7c70	Rat	G protein-coupled receptor signaling pathway		IEA	RGD:5131483	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or7c70	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276\|InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or7c70	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or7c70	Rat	sensory perception of smell	involved_in	IEA	UniProtKB-KW:KW-0552	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or7c70	Rat	signal transduction	involved_in	IBA	PANTHER:PTN001239850\|UniProtKB:P34982	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or7c70	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or7c70	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or7c70	Rat	membrane	located_in	IEA	InterPro:IPR000276\|InterPro:IPR000725\|InterPro:IPR017452	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or7c70	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Or7c70	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or7c70	Rat	plasma membrane	is_active_in	IBA	PANTHER:PTN001239850\|UniProtKB:A6NND4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or7c70	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or7c70	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or7c70	Rat	olfactory receptor activity		IEA	RGD:5131483	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or7c70	Rat	olfactory receptor activity	enables	IBA	MGI:1333746\|PANTHER:PTN001239850\|UniProtKB:A6NND4\|UniProtKB:P34982	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or7c70	Rat	olfactory receptor activity	enables	IEA	InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or7c70	Rat	protein binding	enables	ISO	RGD:1344773	1624291	UniProtKB:P63167 PMID:32296183	RGD	PMID:32296183

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or7c70	Rat	taste/olfaction phenotype		IEA		1303377		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Or7c70
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	11,461,214 - 11,468,390 (+)	NCBI		GRCr8
mRatBN7.2	7	10,810,624 - 10,811,586 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	10,799,830 - 10,813,059 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	13,626,580 - 13,627,542 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	15,504,023 - 15,504,985 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	13,387,098 - 13,388,060 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	13,698,647 - 13,699,609 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	13,698,647 - 13,699,609 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	13,862,639 - 13,863,601 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	12,362,119 - 12,363,081 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	12,362,118 - 12,363,081 (+)	NCBI
Celera	7	8,927,720 - 8,928,682 (+)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

OR7C2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	14,941,489 - 14,942,448 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	14,941,489 - 14,942,448 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	15,052,301 - 15,053,260 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	14,913,301 - 14,914,260 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	14,913,300 - 14,914,260	NCBI
Celera	19	14,948,010 - 14,948,972 (+)	NCBI		Celera
Cytogenetic Map	19	p13.12	NCBI
HuRef	19	14,620,103 - 14,621,065 (+)	NCBI		HuRef
CHM1_1	19	15,048,677 - 15,049,639 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	15,066,276 - 15,067,238 (+)	NCBI		T2T-CHM13v2.0

Or7c70
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	78,682,785 - 78,683,747 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	78,680,886 - 78,688,000 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	78,846,951 - 78,847,913 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	78,845,052 - 78,852,166 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	78,309,696 - 78,310,658 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	78,249,901 - 78,251,042 (-)	NCBI		MGSCv36	mm8
Celera	10	79,868,662 - 79,869,624 (-)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

LOC102015215
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955495	8,328,332 - 8,329,291 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100976323
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	19,855,628 - 19,859,251 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	18,874,051 - 18,876,283 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	14,490,688 - 14,491,799 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	15,461,808 - 15,462,770 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	15,461,808 - 15,462,770 (+)	Ensembl	panpan1.1		panPan2

OR7C2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	47,144,015 - 47,147,260 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	46,995,100 - 46,996,089 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	47,637,212 - 47,638,201 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	20	46,867,965 - 46,868,954 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	47,286,022 - 47,287,011 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	47,558,285 - 47,559,274 (-)	NCBI		UU_Cfam_GSD_1.0

LOC100736663
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	2	62,630,428 - 62,632,229 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	62,262,867 - 62,264,606 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OR7C2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	13,532,712 - 13,534,017 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	13,532,971 - 13,533,933 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	6,060,427 - 6,061,572 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Or7c70
3 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	106
Count of miRNA genes:	91
Interacting mature miRNAs:	92
Transcripts:	ENSRNOT00000067342
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	664270	26029351	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

ectoderm	nervous system
4	4


RefSeq Transcripts	NM_001000419	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063263161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC099165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000067342 ⟹ ENSRNOP00000061889

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	10,799,830 - 10,812,586 (+)	Ensembl
Rnor_6.0 Ensembl	7	13,698,647 - 13,699,609 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113394 ⟹ ENSRNOP00000083346

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	10,800,272 - 10,813,059 (+)	Ensembl

RefSeq Acc Id:

NM_001000419 ⟹ NP_001000419

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	11,461,214 - 11,462,176 (+)	NCBI
mRatBN7.2	7	10,810,624 - 10,811,586 (+)	NCBI
Rnor_6.0	7	13,698,647 - 13,699,609 (+)	NCBI
Rnor_5.0	7	13,862,639 - 13,863,601 (+)	NCBI
RGSC_v3.4	7	12,362,119 - 12,363,081 (+)	RGD
Celera	7	8,927,720 - 8,928,682 (+)	RGD

Sequence:

show sequence

ATGGAAAGAGAAAACCAAACAGGAGACAGAAAGTTTCTCCTCCTGGGATTCACAGAAGACTCTGACCTACAGTCATTCTTCTTTGGGTTGCTTCTCTCCATGTACCTGGTCAGCATCACAGGCAACTT
ACTCATCGTCTTGGCCATCGTATCAGACCACCACCTACACACGCCTATGTACTTCTTCCTCTCCAACCTGTCCATAGCTGACATTGGCTTCACCTCCACCACCATCCCAAAGGCTTTGCAGAATATCC
ACACACAAAGCAAACTCATCTCTTTCACAGGCTGTATCACACAGATTTTTTTTTTCATTGTGTTTGGATGCCTGGACAATTTACTCCTAACAGTGATGGCGTATGACCGCTTTATGGCCATCTGCCAT
CCCCTGCACTATGTGGTCATCATGAATTCTTGTTTCTGTGTGATGCTGGCCCTTGGATCATGGATAGTTAGTGTCATGAGTTCCCTGCCCGAGACCTTGACTGTGTTAAGGCTATCCTTCTGTACAAA
TATGGAAATTCCACACTTTTTCTGTGATCTTCCTGAAGTCCTGAAGCTTGCCTGTTCTGATACCCTTGTCAATAACATTGTGATATATTCTATAACTATAGTCATAGCTGGTTTCCCATTCTCTGGGA
TTCTATTGTCATATTCTCGGATTTTCTCCTCCATCTTAAGAATTCCTTCAGCTGGGGGCAAGTACAAAGCCGTTTCAACCTGTGGGTCTCACCTCTTGGTAGTCTTCTTGTTCTACAGCAATGGTCTT
GGGGTCTACCTTAGCTCCGCAGCCACATCATCTTCTAGAATGAGTCTAGTTGCCTCATTGATGTACACCATGGTCACTCCCATGCTGAACCCCTTCATCTACAGCCTAAGGAACAAGGACATGCAGAA
GGCCTTGGGAAAACTCCTCAGGAAAATCATGCTTCTTGGTGAAGGGAGCATAGCAGGATTCCCATAA

hide sequence

RefSeq Acc Id:

XM_063263161 ⟹ XP_063119231

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	11,461,214 - 11,468,390 (+)	NCBI


Protein RefSeqs	NP_001000419	(Get FASTA)	NCBI Sequence Viewer
	XP_063119231	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL89443	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000061889.2
	ENSRNOP00000083346.1
	ENSRNOP00000104548

RefSeq Acc Id:

NP_001000419 ⟸ NM_001000419

- UniProtKB:

D4A5L0 (UniProtKB/TrEMBL), A0A8I6GAN4 (UniProtKB/TrEMBL), A6K923 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MERENQTGDRKFLLLGFTEDSDLQSFFFGLLLSMYLVSITGNLLIVLAIVSDHHLHTPMYFFLSNLSIADIGFTSTTIPKALQNIHTQSKLISFTGCITQIFFFIVFGCLDNLLLTVMAYDRFMAICH
PLHYVVIMNSCFCVMLALGSWIVSVMSSLPETLTVLRLSFCTNMEIPHFFCDLPEVLKLACSDTLVNNIVIYSITIVIAGFPFSGILLSYSRIFSSILRIPSAGGKYKAVSTCGSHLLVVFLFYSNGL
GVYLSSAATSSSRMSLVASLMYTMVTPMLNPFIYSLRNKDMQKALGKLLRKIMLLGEGSIAGFP

hide sequence

Ensembl Acc Id:

ENSRNOP00000061889 ⟸ ENSRNOT00000067342

Ensembl Acc Id:

ENSRNOP00000083346 ⟸ ENSRNOT00000113394

RefSeq Acc Id:	XP_063119231 ⟸ XM_063263161
- Peptide Label:	isoform X1
- UniProtKB:	D4A5L0 (UniProtKB/TrEMBL)

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A5L0-F1-model_v2	AlphaFold	D4A5L0	1-320	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-34850	BioCyc
Ensembl Genes	ENSRNOG00000042262	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000073768	ENTREZGENE
Ensembl Transcript	ENSRNOT00000067342.2	UniProtKB/TrEMBL
	ENSRNOT00000113394.1	UniProtKB/TrEMBL
	ENSRNOT00000121907	ENTREZGENE
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
KEGG Report	rno:299588	UniProtKB/TrEMBL
NCBI Gene	299588	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or7c70	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000042262	RatGTEx
	ENSRNOG00000073768	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0A8I6GAN4	ENTREZGENE, UniProtKB/TrEMBL
	A6K923	ENTREZGENE, UniProtKB/TrEMBL
	D4A5L0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or7c70	olfactory receptor family 7 subfamily C member 70	Olr1086	olfactory receptor 1086	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr1086	olfactory receptor 1086	Olr1086_predicted	olfactory receptor 1086 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr1086_predicted	olfactory receptor 1086 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Mammalian Phenotype