Advanced Search (OLGA)

Gene: Or5ar1 (olfactory receptor family 5 subfamily AR member 1) Rattus norvegicus

Analyze

Symbol:

Or5ar1

Name:

olfactory receptor family 5 subfamily AR member 1

RGD ID:

1333623

Description:

Predicted to enable copper ion binding activity; odorant binding activity; and olfactory receptor activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception. Predicted to be located in plasma membrane. Orthologous to human OR5AR1 (olfactory receptor family 5 subfamily AR member 1); INTERACTS WITH bisphenol A; aflatoxin B1 (ortholog); copper(II) sulfate (ortholog).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 462; olfactory receptor gene Olr462; olfactory receptor Olr462; Olr462

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OR5AR1 (olfactory receptor family 5 subfamily AR member 1)	HGNC	Ensembl, HomoloGene, Inparanoid, Panther
Mus musculus (house mouse):	Or5ar1 (olfactory receptor family 5 subfamily AR member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100973224 (olfactory receptor 5AR1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	OR5AR1 (olfactory receptor family 5 subfamily AR member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Or5ar1 (olfactory receptor family 5 subfamily AR member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OR5AR1 (olfactory receptor family 5 subfamily AR member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	LOC101700912 (olfactory receptor 1019)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	LOC116900258 (olfactory receptor 1019)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	OR5AR1 (olfactory receptor family 5 subfamily AR member 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	OR5AR1 (olfactory receptor family 5 subfamily AR member 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Or5ar1 (olfactory receptor family 5 subfamily AR member 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Or5ar1 (olfactory receptor family 5 subfamily AR member 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-37	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-36	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-38	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-35	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cdca4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	XB5876791 [provisional:olfr1019]	Alliance	DIOPT (OMA\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	or5f1l1.3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	or5f1l1.2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	or2t27	Alliance	DIOPT (OMA\|PhylomeDB)
Caenorhabditis elegans (roundworm):	srsx-39	Alliance	DIOPT (Hieranoid\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	or8u9	Alliance	DIOPT (Hieranoid\|OMA)
Xenopus tropicalis (tropical clawed frog):	or15h2	Alliance	DIOPT (Hieranoid\|OMA)
Xenopus tropicalis (tropical clawed frog):	or15h3	Alliance	DIOPT (Hieranoid\|OMA)
Xenopus tropicalis (tropical clawed frog):	or15h1l	Alliance	DIOPT (Hieranoid\|OMA)
Xenopus tropicalis (tropical clawed frog):	or5dn1b	Alliance	DIOPT (Ensembl Compara\|OMA)
Xenopus tropicalis (tropical clawed frog):	or15h1k	Alliance	DIOPT (Hieranoid\|OMA)
Xenopus tropicalis (tropical clawed frog):	or5dv1	Alliance	DIOPT (Ensembl Compara\|OMA)
Xenopus tropicalis (tropical clawed frog):	or5dn1	Alliance	DIOPT (Ensembl Compara\|OMA)
Xenopus tropicalis (tropical clawed frog):	or15h1g	Alliance	DIOPT (Hieranoid\|OMA)
Xenopus tropicalis (tropical clawed frog):	or15h1j	Alliance	DIOPT (Hieranoid\|OMA)
Xenopus tropicalis (tropical clawed frog):	or15h2	Alliance	DIOPT (Hieranoid\|OMA)
Xenopus tropicalis (tropical clawed frog):	or15h1h	Alliance	DIOPT (Hieranoid\|OMA)
Xenopus tropicalis (tropical clawed frog):	or15h1i	Alliance	DIOPT (Hieranoid\|OMA)
Xenopus tropicalis (tropical clawed frog):	or5dv1	Alliance	DIOPT (Ensembl Compara\|OMA)
Xenopus tropicalis (tropical clawed frog):	or15h1j	Alliance	DIOPT (Hieranoid\|OMA)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	91,314,261 - 91,315,193 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	91,314,261 - 91,315,193 (-)	Ensembl				GRCr8
mRatBN7.2	3	70,907,592 - 70,908,524 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	70,906,547 - 70,912,666 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	74,302,046 - 74,302,978 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	82,900,572 - 82,901,504 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	80,676,181 - 80,677,113 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	3	89,184,701 - 89,185,633 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	3	96,118,938 - 96,119,870 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	3	88,030,722 - 88,031,654 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	3	69,342,523 - 69,343,455 (-)	NCBI		F344_StmMcwi
Rnor_6.0	3	73,225,695 - 73,226,627 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	73,225,695 - 73,226,627 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	79,794,251 - 79,795,183 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	69,087,938 - 69,088,870 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	70,239,965 - 70,240,897 (-)	NCBI		Celera
RGSC_v3.1	3	68,984,309 - 68,985,242 (-)	NCBI
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

aflatoxin B1 (ISO)

bisphenol A (EXP)

copper(II) sulfate (ISO)

CU-O LINKAGE (ISO)

resveratrol (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception (IEA,ISO)

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IEA)

sensory perception of smell (IEA)

signal transduction (IEA)

Cellular Component

membrane (IEA)

plasma membrane (IEA,ISO)

Molecular Function

copper ion binding (IEA,ISO)

G protein-coupled receptor activity (IEA)

odorant binding (IBA,IEA,ISO)

olfactory receptor activity (IBA,IEA,ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:29659735

Genomics

Comparative Map Data

Or5ar1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	91,314,261 - 91,315,193 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	91,314,261 - 91,315,193 (-)	Ensembl				GRCr8
mRatBN7.2	3	70,907,592 - 70,908,524 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	70,906,547 - 70,912,666 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	74,302,046 - 74,302,978 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	82,900,572 - 82,901,504 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	80,676,181 - 80,677,113 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	3	89,184,701 - 89,185,633 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	3	96,118,938 - 96,119,870 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	3	88,030,722 - 88,031,654 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	3	69,342,523 - 69,343,455 (-)	NCBI		F344_StmMcwi
Rnor_6.0	3	73,225,695 - 73,226,627 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	73,225,695 - 73,226,627 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	79,794,251 - 79,795,183 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	69,087,938 - 69,088,870 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	70,239,965 - 70,240,897 (-)	NCBI		Celera
RGSC_v3.1	3	68,984,309 - 68,985,242 (-)	NCBI
Cytogenetic Map	3	q24	NCBI

OR5AR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	56,663,686 - 56,664,618 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	56,663,686 - 56,664,618 (+)	Ensembl			hg38	GRCh38
GRCh37	11	56,431,162 - 56,432,094 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	56,187,738 - 56,188,670 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	11	56,187,737 - 56,188,670	NCBI
Celera	11	53,778,847 - 53,779,779 (+)	NCBI		Celera
Cytogenetic Map	11	q12.1	NCBI
HuRef	11	52,768,591 - 52,769,523 (+)	NCBI		HuRef
CHM1_1	11	56,297,433 - 56,298,365 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	56,601,694 - 56,602,626 (+)	NCBI		T2T-CHM13v2.0

Or5ar1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	85,671,201 - 85,672,133 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	85,669,965 - 85,675,827 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	85,840,857 - 85,841,789 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	85,839,621 - 85,845,483 (-)	Ensembl			mm10	GRCm38
MGSCv37	2	85,681,014 - 85,681,946 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	85,641,696 - 85,642,628 (-)	NCBI		MGSCv36	mm8
Celera	2	87,424,083 - 87,425,015 (-)	NCBI		Celera
Cytogenetic Map	2	D	NCBI
cM Map	2	49.68	NCBI

LOC100973224
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	57,816,482 - 57,817,414 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	58,832,061 - 58,832,993 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	51,899,738 - 51,900,751 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

OR5AR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Dog10K_Boxer_Tasha	18	38,882,635 - 38,883,570 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	40,017,489 - 40,018,424 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	40,017,492 - 40,018,424 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	39,619,784 - 39,620,719 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	39,186,836 - 39,187,771 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	39,769,496 - 39,770,432 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Or5ar1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	15,769,486 - 15,770,512 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936581	5,883,308 - 5,884,334 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OR5AR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	16,374,611 - 16,377,659 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	16,374,765 - 16,375,827 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	113,701,543 - 113,702,555 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

LOC101700912
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624864	3,906,483 - 3,907,415 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624864	3,906,483 - 3,907,415 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

LOC116900258
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	63,159,509 - 63,160,441 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Or5ar1
4 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	64
Count of miRNA genes:	60
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000012746
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	73592611	110333156	Rat
1358293	Bw38	Body weight QTL 38	6	0.0000031	body mass (VT:0001259)	body weight (CMO:0000012)	3	74364268	119364268	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	136118980	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	48876619	93876619	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	48876619	93876619	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	47904172	92904172	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	85062224	136118980	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	85062224	136118980	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	48657744	93657744	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	81425008	141509147	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	70845569	136091483	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	58925062	103925062	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	70311536	115311536	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	81541464	126563126	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	48657744	93657744	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	50766145	95766145	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	90755164	141509147	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	50766145	95766145	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	48657744	93657744	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	48657744	93657744	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	48657744	93657744	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

ectoderm	endocrine system	endoderm	exocrine system	hepatobiliary system	mesenchyme	mesoderm	musculoskeletal system	respiratory system
1	1	2	1	1	2	1	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001000295	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012746 ⟹ ENSRNOP00000012746

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	70,906,547 - 70,912,666 (-)	Ensembl
Rnor_6.0 Ensembl	3	73,225,695 - 73,226,627 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097838 ⟹ ENSRNOP00000094710

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	70,906,547 - 70,912,666 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000121273 ⟹ ENSRNOP00000098921

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	91,314,261 - 91,315,193 (-)	Ensembl

RefSeq Acc Id:

NM_001000295 ⟹ NP_001000295

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	91,314,261 - 91,315,193 (-)	NCBI
mRatBN7.2	3	70,907,592 - 70,908,524 (-)	NCBI
Dahl_SR_JrHsd	3	89,184,701 - 89,185,633 (-)	NCBI
Lyon_Normotensive	3	96,118,938 - 96,119,870 (-)	NCBI
Lyon_Hypertensive	3	88,030,722 - 88,031,654 (-)	NCBI
F344_StmMcwi	3	69,342,523 - 69,343,455 (-)	NCBI
Rnor_6.0	3	73,225,695 - 73,226,627 (-)	NCBI
Rnor_5.0	3	79,794,251 - 79,795,183 (-)	NCBI
RGSC_v3.4	3	69,087,938 - 69,088,870 (-)	RGD
Celera	3	70,239,965 - 70,240,897 (-)	RGD

Sequence:

show sequence

ATGCATAAAGAAAATCACTCAGTAGTGACTGAATTTATCTTTATGGGCATCACTCAAGACCCTC
AGTTGCAGATCATCTTTTTTGTGGTCTTCCTCATTGTCTACCTGGTCAATGTGATAGGGAATGT
TGGCATGATCATCCTGATCATAACAGACAGTCAGCTTCACACTCCCATGTACTTTTTTCTCTGC
AACCTCTCCTTTGTCGACCTGGGCTACTCATCAGCCATTGCTCCCAGGATGCTGGCTGATTGCC
TAACAAAGCACAAAGTTATCTCTTTTTCCAGCTGTGCTACCCAATTTGCTTTCTTCGTAGGTTT
TGTGGATGCTGAATGCTATGTCCTAGCTGCCATGGCCTATGACCGCTTCGTGGCCATCTGCAGA
CCTCTCCACTATAGCACTCTCATGTCCAAAAAAGTCTGCTTGGTCCTAATGCTGGGCTCTTACT
TGGCTGGCCTGGTGAGTTTAGTGGCCCACACATCTCTCACTTTCAGCCTCAGTTACTGTGCTTC
CAATGTCATCAACCATTTCTTCTGTGAAATTCCACCACTCTTGGCTCTCTCTTGCTCAGATACC
TACATTAGTGAGATACTGCTCTTTAGTTTGTGTGGATTCATTGAATTCAGCACCATCCTTATCA
TCTTCATCTCCTATGCTTTTATTCTTATTGCCATCATCAGAATGCGCTCAGCTGAAGGCCGCCT
AAAGGCTTTTTCGACCTGTGGGTCTCATCTTACTGGTGTCACCCTTTTTTATGGTACAGTCATG
TTCATGTACCTGAGGCCAACATCCAGCTACTCCCTGGACCAAGACAAGTGGGCCTCTGTGTTCT
ACACAATTATCATTCCTATGCTGAACCCCTTGATCTACAGTTTGAGGAACAAAGATGTGAAAGC
GGCTTTCAAAAAACTGATTGGAAAGAAACCTCAATAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001000295	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL79351	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000098921
	ENSRNOP00000098921.1

RefSeq Acc Id:

NP_001000295 ⟸ NM_001000295

- UniProtKB:

D3ZD44 (UniProtKB/TrEMBL), A6HMV0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MHKENHSVVTEFIFMGITQDPQLQIIFFVVFLIVYLVNVIGNVGMIILIITDSQLHTPMYFFLC
NLSFVDLGYSSAIAPRMLADCLTKHKVISFSSCATQFAFFVGFVDAECYVLAAMAYDRFVAICR
PLHYSTLMSKKVCLVLMLGSYLAGLVSLVAHTSLTFSLSYCASNVINHFFCEIPPLLALSCSDT
YISEILLFSLCGFIEFSTILIIFISYAFILIAIIRMRSAEGRLKAFSTCGSHLTGVTLFYGTVM
FMYLRPTSSYSLDQDKWASVFYTIIIPMLNPLIYSLRNKDVKAAFKKLIGKKPQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000012746 ⟸ ENSRNOT00000012746

Ensembl Acc Id:

ENSRNOP00000094710 ⟸ ENSRNOT00000097838

Ensembl Acc Id:

ENSRNOP00000098921 ⟸ ENSRNOT00000121273

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZD44-F1-model_v2	AlphaFold	D3ZD44	1-310	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1333623	AgrOrtholog
BioCyc Gene	G2FUF-49102	BioCyc
Ensembl Genes	ENSRNOG00000009624	Ensembl
	ENSRNOG00000079508	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000121273	ENTREZGENE
	ENSRNOT00000121273.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
KEGG Report	rno:295732	UniProtKB/TrEMBL
NCBI Gene	295732	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or5ar1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000009624	RatGTEx
	ENSRNOG00000079508	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A6HMV0	ENTREZGENE, UniProtKB/TrEMBL
	D3ZD44	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or5ar1	olfactory receptor family 5 subfamily AR member 1	Olr462	olfactory receptor 462	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr462	olfactory receptor 462	Olr462_predicted	olfactory receptor 462 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr462_predicted	olfactory receptor 462 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Mammalian Phenotype