Advanced Search (OLGA)

Gene: Or10h1d (olfactory receptor family 10 subfamily H member 1D) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Or10h1d (Ensembl: Or10h1)

Name:

olfactory receptor family 10 subfamily H member 1D (Ensembl:olfactory receptor family 10 subfamily H member 1)

RGD ID:

1333565

Description:

Predicted to enable G protein-coupled receptor activity and olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Orthologous to human OR10H1 (olfactory receptor family 10 subfamily H member 1); INTERACTS WITH atrazine; cadmium dichloride; indole-3-methanol.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 1095; olfactory receptor gene Olr1095; olfactory receptor Olr1095; Olr1095; ratchr7-14452375-14451419_ORF

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	13,490,046 - 13,491,002 (-)	NCBI		GRCr8
mRatBN7.2	7	12,839,664 - 12,840,620 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	12,839,050 - 12,849,389 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	15,649,759 - 15,650,715 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	17,527,070 - 17,528,026 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	15,398,589 - 15,399,545 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	15,621,989 - 15,622,945 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	15,621,989 - 15,622,945 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	15,788,049 - 15,789,005 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	14,451,419 - 14,452,375 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	14,451,418 - 14,452,375 (-)	NCBI
Celera	7	11,729,190 - 11,730,146 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or10h1d	Rat	4-nonylphenol	multiple interactions	ISO	RGD:1353311	6480464	[4-tert-octylphenol co-treated with 4-nonylphenol] results in increased expression of OR10H1 mRNA	CTD	PMID:23626723
Or10h1d	Rat	4-tert-Octylphenol	multiple interactions	ISO	RGD:1353311	6480464	[4-tert-octylphenol co-treated with 4-nonylphenol] results in increased expression of OR10H1 mRNA	CTD	PMID:23626723
Or10h1d	Rat	aristolochic acid A	increases expression	ISO	RGD:1353311	6480464	aristolochic acid I results in increased expression of OR10H1 mRNA	CTD	PMID:33212167
Or10h1d	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of OR10H1 gene	CTD	PMID:35440735
Or10h1d	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1353311	6480464	Benzo(a)pyrene results in increased methylation of OR10H1 exon; Benzo(a)pyrene results in increased methylation of OR10H1 more ...	CTD	PMID:27901495
Or10h1d	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of OR10H1D promoter	CTD	PMID:22457795
Or10h1d	Rat	CGP 52608	multiple interactions	ISO	RGD:1353311	6480464	CGP 52608 promotes the reaction [RORA protein binds to OR10H1 gene]	CTD	PMID:28238834
Or10h1d	Rat	indole-3-methanol	affects expression	EXP		6480464	indole-3-carbinol affects the expression of OR10H1D mRNA	CTD	PMID:21396975
Or10h1d	Rat	p-tert-Amylphenol	multiple interactions	ISO	RGD:1353311	6480464	[4-tert-octylphenol co-treated with 4-nonylphenol] results in increased expression of OR10H1 mRNA	CTD	PMID:23626723

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or10h1d	Rat	detection of chemical stimulus involved in sensory perception of smell	involved_in	IBA	MGI:106182\|PANTHER:PTN002818000	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or10h1d	Rat	detection of chemical stimulus involved in sensory perception of smell		IEA	RGD:5131483	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or10h1d	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276\|InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or10h1d	Rat	G protein-coupled receptor signaling pathway		IEA	RGD:5131483	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or10h1d	Rat	sensory perception of smell	involved_in	IEA	UniProtKB-KW:KW-0552	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or10h1d	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or10h1d	Rat	membrane	located_in	IEA	InterPro:IPR000276\|InterPro:IPR000725\|InterPro:IPR017452	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or10h1d	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or10h1d	Rat	plasma membrane	is_active_in	IBA	MGI:106648\|PANTHER:PTN002818000\|UniProtKB:Q8N628\|UniProtKB:Q8NGE3\|UniProtKB:Q8NGS8\|UniProtKB:Q8NGS9\|UniProtKB:Q8NGT0\|UniProtKB:Q8NHC4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or10h1d	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or10h1d	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or10h1d	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or10h1d	Rat	olfactory receptor activity	enables	IEA	InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or10h1d	Rat	olfactory receptor activity		IEA	RGD:5131483	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or10h1d	Rat	olfactory receptor activity	enables	IBA	MGI:106182\|MGI:106648\|MGI:3030792\|MGI:3030794\|MGI:3030795\|PANTHER:PTN002818000\|UniProtKB:Q8NHC4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or10h1d	Rat	taste/olfaction phenotype		IEA		1303377		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Or10h1d
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	13,490,046 - 13,491,002 (-)	NCBI		GRCr8
mRatBN7.2	7	12,839,664 - 12,840,620 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	12,839,050 - 12,849,389 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	15,649,759 - 15,650,715 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	17,527,070 - 17,528,026 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	15,398,589 - 15,399,545 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	15,621,989 - 15,622,945 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	15,621,989 - 15,622,945 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	15,788,049 - 15,789,005 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	14,451,419 - 14,452,375 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	14,451,418 - 14,452,375 (-)	NCBI
Celera	7	11,729,190 - 11,730,146 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

OR10H1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	15,804,549 - 15,815,664 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	15,804,549 - 15,815,664 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	15,915,359 - 15,926,474 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	15,778,817 - 15,779,936 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	15,778,890 - 15,779,847	NCBI
Celera	19	15,815,749 - 15,816,868 (-)	NCBI		Celera
Cytogenetic Map	19	p13.12	NCBI
HuRef	19	15,488,958 - 15,490,077 (-)	NCBI		HuRef
CHM1_1	19	15,917,272 - 15,918,391 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	15,932,396 - 15,943,489 (-)	NCBI		T2T-CHM13v2.0

Or10h1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	33,418,036 - 33,418,983 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	33,410,276 - 33,421,480 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	33,199,062 - 33,200,009 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	33,191,302 - 33,202,506 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	33,336,007 - 33,336,954 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	33,336,007 - 33,336,954 (+)	NCBI		MGSCv36	mm8
Cytogenetic Map	17	B1	NCBI
cM Map	17	17.98	NCBI

OR10H2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	46,464,187 - 46,465,260 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	46,464,202 - 46,465,137 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	46,361,158 - 46,362,117 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	46,952,673 - 46,953,632 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	20	46,187,201 - 46,188,159 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	46,599,300 - 46,600,259 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	46,875,256 - 46,876,215 (+)	NCBI		UU_Cfam_GSD_1.0

LOC100524975
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	2	61,695,775 - 61,696,719 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	61,305,421 - 61,306,365 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103234087
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	14,386,026 - 14,387,326 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	14,386,151 - 14,387,104 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	5,106,871 - 5,107,755 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants in Or10h1d
4 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	87
Count of miRNA genes:	75
Interacting mature miRNAs:	77
Transcripts:	ENSRNOT00000051928
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	664270	26029351	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

ectoderm	endocrine system	mesenchyme	mesoderm	nervous system	reproductive system
2	1	1	1	1	9


RefSeq Transcripts	NM_001000416	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000051928 ⟹ ENSRNOP00000049679

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	12,574,956 - 12,587,973 (-)	Ensembl
Rnor_6.0 Ensembl	7	15,621,989 - 15,622,945 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000071081 ⟹ ENSRNOP00000066743

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	12,839,050 - 12,849,389 (-)	Ensembl

RefSeq Acc Id:

NM_001000416 ⟹ NP_001000416

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	13,490,046 - 13,491,002 (-)	NCBI
mRatBN7.2	7	12,839,664 - 12,840,620 (-)	NCBI
Rnor_6.0	7	15,621,989 - 15,622,945 (+)	NCBI
Rnor_5.0	7	15,788,049 - 15,789,005 (+)	NCBI
RGSC_v3.4	7	14,451,419 - 14,452,375 (-)	RGD
Celera	7	11,729,190 - 11,730,146 (-)	RGD

Sequence:

show sequence

ATGGCTGTCACGTTGGGGAGAAACTACACCTTTGTGTCAGAGTTCATCCTCATTGGCTTCTCTACCTTCCCTCATCTTCAGCTGATGTTCTTCCTGCTGTTCCTGCTCATGTACCTCTTCACACTGCT
AGGCAACCTGCTCATCATGGCCACCATCTGGAGTGAACACAGTCTCCACACACCCATGTACCGCTTCCTGTGCGCCCTCTCCATCTCTGAGATTTTCTACACCTTTGCCATCATCCCACGCATGTTGG
CCGACCTGCTCTCTGCGCTTCACTCCATCGCCCTTCTGGCCTGTGCCAGCCAGATGTTCTTCTCCTTCATGTTTGGCTTCACCCACTCCTTTCTACTCACCGTCATGGGCTATGACCGCTATGTGGCT
ATCTGTCACCCACTGAGATACAATGTGCTCATGAGCCCCCGTGGCTGTGCCTGCCTGGTTGCCTGGTCCTGGGTTGGTGGATCATTCATGGGGACAGTGGTGACAACAGCCATTTTCAACCTCACATT
CTGTGGACCCAGTGAGATCCACCATTTTGCTTGTCATGTCCCACCTCTACTGAAGTTGGCATGTGGAAAGAATGTACTGGCAGTGGCAAAGGGTGTGGGGATGGTGTGCATCACAGCCCTCCTGGGAT
GCTTTCTCCTCATCCTCCTCTCCTATGCCTTCATTGTGGCTACCATCTTGAAGATACCATCAGCTGAGGGTCGGCACAAGGCTTTCTCCACATGTGCATCCCACCTCACAGTAGTGGTTGTACATTAC
GGCTTTGCCTCTGTCATCTACCTCAAGCCTAAGGGTCCCAAGTCTCTGGAAGGAGATACTCTGATGGGTATCACCTATACAGTCCTCACCCCTTTCCTTAGTCCTATCATCTTCAGCCTCAGGAACAA
GGAGCTAAAGAATGCCATGAAGAAGGCCTTCTTAAGCAAACTCTATCCAGAGAAAATGTAA

hide sequence


Protein RefSeqs	NP_001000416	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000066743.2
	ENSRNOP00000102746

RefSeq Acc Id:

NP_001000416 ⟸ NM_001000416

- UniProtKB:

M0RB21 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAVTLGRNYTFVSEFILIGFSTFPHLQLMFFLLFLLMYLFTLLGNLLIMATIWSEHSLHTPMYRFLCALSISEIFYTFAIIPRMLADLLSALHSIALLACASQMFFSFMFGFTHSFLLTVMGYDRYVA
ICHPLRYNVLMSPRGCACLVAWSWVGGSFMGTVVTTAIFNLTFCGPSEIHHFACHVPPLLKLACGKNVLAVAKGVGMVCITALLGCFLLILLSYAFIVATILKIPSAEGRHKAFSTCASHLTVVVVHY
GFASVIYLKPKGPKSLEGDTLMGITYTVLTPFLSPIIFSLRNKELKNAMKKAFLSKLYPEKM

hide sequence

Ensembl Acc Id:

ENSRNOP00000049679 ⟸ ENSRNOT00000051928

Ensembl Acc Id:

ENSRNOP00000066743 ⟸ ENSRNOT00000071081

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZTF8-F1-model_v2	AlphaFold	D3ZTF8	1-318	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-34766	BioCyc
Ensembl Genes	ENSRNOG00000050274	Ensembl
	ENSRNOG00000050907	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000091234	ENTREZGENE
Ensembl Transcript	ENSRNOT00000071081.2	UniProtKB/TrEMBL
	ENSRNOT00000148830	ENTREZGENE
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
KEGG Report	rno:299576	UniProtKB/TrEMBL
NCBI Gene	299576	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or10h1d	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000050274	RatGTEx
	ENSRNOG00000050907	RatGTEx
	ENSRNOG00000091234	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	M0RB21	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or10h1d	olfactory receptor family 10 subfamily H member 1D	Olr1095	olfactory receptor 1095	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr1095	olfactory receptor 1095	Olr1095_predicted	olfactory receptor 1095 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr1095_predicted	olfactory receptor 1095 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Mammalian Phenotype