Advanced Search (OLGA)

Gene: Or52m1 (olfactory receptor family 52 subfamily M member 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Or52m1

Name:

olfactory receptor family 52 subfamily M member 1

RGD ID:

1333547

Description:

Predicted to enable G protein-coupled receptor activity and olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Orthologous to human OR52M1 (olfactory receptor family 52 subfamily M member 1); INTERACTS WITH 2,6-dinitrotoluene; bisphenol A; 1,2-dimethylhydrazine (ortholog).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 48; olfactory receptor gene Olr48; olfactory receptor Olr48; Olr48

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	166,477,144 - 166,478,097 (+)	NCBI		GRCr8
mRatBN7.2	1	157,065,217 - 157,066,170 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	157,065,217 - 157,066,170 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	165,042,972 - 165,043,925 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	172,223,048 - 172,224,001 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	165,130,029 - 165,130,982 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	167,786,465 - 167,787,418 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	167,786,337 - 167,787,409 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	173,971,894 - 173,972,847 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	160,275,494 - 160,276,447 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	160,354,510 - 160,355,464 (+)	NCBI
Celera	1	155,130,279 - 155,131,232 (+)	NCBI		Celera
Cytogenetic Map	1	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or52m1	Rat	delta beta-thalassemia		ISO	OR52M1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Thalassemia and gamma-delta-beta	ClinVar	PMID:2798417

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or52m1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Or52m1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of OR52M1 mRNA	CTD	PMID:22206623
Or52m1	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of OR52M1 mRNA	CTD	PMID:21346803
Or52m1	Rat	aflatoxin B1	increases methylation	ISO	OR52M1 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of OR52M1 gene	CTD	PMID:27153756
Or52m1	Rat	arsenite(3-)	decreases methylation	ISO	OR52M1 (Homo sapiens)	6480464	arsenite results in decreased methylation of OR52M1 promoter	CTD	PMID:23974009
Or52m1	Rat	benzo[a]pyrene	increases methylation	ISO	OR52M1 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of OR52M1 promoter	CTD	PMID:27901495
Or52m1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of OR52M1 mRNA	CTD	PMID:25181051
Or52m1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of OR52M1 gene	CTD	PMID:28505145
Or52m1	Rat	bisphenol A	decreases methylation	ISO	OR52M1 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of OR52M1 gene	CTD	PMID:31601247
Or52m1	Rat	CGP 52608	multiple interactions	ISO	OR52M1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to OR52M1 gene]	CTD	PMID:28238834
Or52m1	Rat	chlorpyrifos	increases expression	ISO	Or52m1 (Mus musculus)	6480464	Chlorpyrifos results in increased expression of OR52M1 mRNA	CTD	PMID:32715474

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or52m1	Rat	detection of chemical stimulus involved in sensory perception of smell	involved_in	IEA	GO:0004984	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Or52m1	Rat	detection of chemical stimulus involved in sensory perception of smell		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or52m1	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or52m1	Rat	G protein-coupled receptor signaling pathway		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or52m1	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276 and InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or52m1	Rat	sensory perception of smell	involved_in	IEA	UniProtKB-KW:KW-0552	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or52m1	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or52m1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or52m1	Rat	membrane	located_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or52m1	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Or52m1	Rat	plasma membrane	is_active_in	IBA	MGI:2157548 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or52m1	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or52m1	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or52m1	Rat	olfactory receptor activity	enables	IBA	PANTHER:PTN002816874 and UniProtKB:Q9H255	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or52m1	Rat	olfactory receptor activity		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or52m1	Rat	olfactory receptor activity	enables	IEA	InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or52m1	Rat	taste/olfaction phenotype		IEA		1303377		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Or52m1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	166,477,144 - 166,478,097 (+)	NCBI		GRCr8
mRatBN7.2	1	157,065,217 - 157,066,170 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	157,065,217 - 157,066,170 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	165,042,972 - 165,043,925 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	172,223,048 - 172,224,001 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	165,130,029 - 165,130,982 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	167,786,465 - 167,787,418 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	167,786,337 - 167,787,409 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	173,971,894 - 173,972,847 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	160,275,494 - 160,276,447 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	160,354,510 - 160,355,464 (+)	NCBI
Celera	1	155,130,279 - 155,131,232 (+)	NCBI		Celera
Cytogenetic Map	1	q32	NCBI

OR52M1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	4,545,191 - 4,546,144 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	4,545,191 - 4,546,144 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	4,566,421 - 4,567,374 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	4,522,997 - 4,523,950 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	4,522,996 - 4,523,950	NCBI
Celera	11	4,690,621 - 4,691,574 (+)	NCBI		Celera
Cytogenetic Map	11	p15.4	NCBI
HuRef	11	4,224,847 - 4,225,800 (+)	NCBI		HuRef
CHM1_1	11	4,566,352 - 4,567,305 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	4,610,461 - 4,611,414 (+)	NCBI		T2T-CHM13v2.0

Or52m1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	102,289,455 - 102,290,408 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	102,287,639 - 102,291,762 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	102,640,248 - 102,641,201 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	102,638,432 - 102,642,555 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	109,788,762 - 109,789,715 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	102,514,069 - 102,515,022 (+)	NCBI		MGSCv36	mm8
Celera	7	103,003,191 - 103,004,144 (+)	NCBI		Celera
Cytogenetic Map	7	E3	NCBI
cM Map	7	54.79	NCBI

LOC100978707
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	7,007,096 - 7,008,049 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	6,963,872 - 6,964,825 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	4,720,053 - 4,721,006 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	4,385,239 - 4,386,192 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	4,385,239 - 4,386,192 (+)	Ensembl	panpan1.1		panPan2

OR52M2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	26,889,008 - 26,889,961 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	26,889,008 - 26,889,961 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	26,666,040 - 26,666,993 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	27,122,740 - 27,123,693 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	21	26,889,051 - 26,890,004 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	27,129,531 - 27,130,484 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	27,016,053 - 27,017,006 (-)	NCBI		UU_Cfam_GSD_1.0

LOC100516094
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	5,588,454 - 5,589,407 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	5,588,354 - 5,589,826 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	6,330,198 - 6,331,151 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants in Or52m1
4 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	34
Count of miRNA genes:	32
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000024945
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889419	Cstrr2	Cold stress response QTL 2		0.05	urine catecholamine amount (VT:0010502)	absolute change in urine norepinephrine level (CMO:0001634)	1	155866514	158592016	Rat
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	121767634	166767634	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383668	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	115585465	172949803	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	155866514	200866514	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	117917486	196963478	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	151646613	196646613	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	154561505	199561505	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	131763437	159756369	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	136745990	163747690	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
9685799	Bp375	Blood pressure QTL 375			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121833674	166833674	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
9685802	Bp376	Blood pressure QTL 376			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	126540680	171540680	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
634315	Niddm45	Non-insulin dependent diabetes mellitus QTL 45	7.16		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	144267916	172949660	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
61379	Bp44	Blood pressure QTL 44	19.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144267916	174133260	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
2313060	Bss71	Bone structure and strength QTL 71	2.6	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	1	118944747	163944747	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
724550	Thym3	Thymus enlargement QTL 3	7.82	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
71118	Thym1	Thymus enlargement QTL 1	10.17	0.001	thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	136829932	181829932	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	136830018	181830018	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1582204	Livw1	Liver weight QTL 1	3.6	0.0003	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	1	155422851	172949803	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	168883176	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
8693608	Alc24	Alcohol consumption QTL 24	2.3	0.74	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	150452391	168228760	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	123556856	196963478	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
631548	Bp88	Blood pressure QTL 88	5	0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	156677124	176484451	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

endoderm	reproductive system	respiratory system
1	2	1


RefSeq Transcripts	NM_001000122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024945 ⟹ ENSRNOP00000024945

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	167,786,337 - 167,787,409 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000024948 ⟹ ENSRNOP00000024948

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	157,065,217 - 157,066,170 (+)	Ensembl

RefSeq Acc Id:

NM_001000122 ⟹ NP_001000122

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	166,477,144 - 166,478,097 (+)	NCBI
mRatBN7.2	1	157,065,217 - 157,066,170 (+)	NCBI
Rnor_6.0	1	167,786,465 - 167,787,418 (+)	NCBI
Rnor_5.0	1	173,971,894 - 173,972,847 (+)	NCBI
RGSC_v3.4	1	160,275,494 - 160,276,447 (+)	RGD
Celera	1	155,130,279 - 155,131,232 (+)	RGD

Sequence:

show sequence

ATGCCTACTTTTCATAATGCCTGCTCAGTACCCAGCTCTTTGTGGCTCACCGGCATCCCAGGACTGGAGTCCCTGCATATGTGGCTCTCCATCCCCTTTGGCTCCATGTACCTGGTGGCTGTGGTGGG
GAATATCACCATCCTAGCTGTGGTAAGGGTAGAGCGCAGCCTGCACCAGCCCATGTACTTCTTTCTGTGCATGCTGGCTGTCATTGACCTGGTTCTGTCAACTTCTACTATGCCCAAACTTCTGGCAA
TTTTCTGGTTTGGTGCTGGCAGCATTGGCCTGGATGCCTGCTTATGTCAAATGTTTCTTATCCATTGCTTTGCTACTGTTGAGTCAGGCATCTTTCTTGCCATGGCTTTTGACCGCTATGTGGCCATC
TGCAATCCATTACGTCATAGCATGGTGCTCACCCAGACAGTGGTGGGTCGTTTGGGGCTGGCCGCCTTGCTCCGAGGAGTTCTTTACATCGGACCCCTACCACTTATGATCCGCCTGAGGTTGCCTCT
TTACAAAACCCGAGTCATCTCCCATTCCTACTGTGAGCACATGGCCGTGGTTGCCTTGACCTGTGGTGACAGCAGAGTTAACAATGTCTATGGGTTGAGCATTGGCTTTCTGGTGTTGATCCTGGATT
CAGTGGCCATTGCTGCTTCCTACGTGATGATTTTTAGGGCTGTGATGGGGTTGGCCACTCCCGAGGCCAGGCTTAAAACCCTGGGGACATGTGGGTCTCATATCTGTGCCATTCTGATTTTCTATGTT
CCCATTGCTGTTTCTTCTCTTATTCACCGGTTTGGCCACCAGGTGCCTCCTCCAATCCACACTTTGCTGGCCAACTTCTATCTTCTCATCCCCCCTATCCTCAATCCCATTGTCTATGCTGTTCGCAC
CAAGCAGATCCGGGACAGGCTTCTTCAGATCCTAAAGACAGGAACCAAGATCAGATGA

hide sequence


Protein RefSeqs	NP_001000122	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM18176	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024948
	ENSRNOP00000024948.4

RefSeq Acc Id:

NP_001000122 ⟸ NM_001000122

- UniProtKB:

D4ACV2 (UniProtKB/TrEMBL), A6I754 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPTFHNACSVPSSLWLTGIPGLESLHMWLSIPFGSMYLVAVVGNITILAVVRVERSLHQPMYFFLCMLAVIDLVLSTSTMPKLLAIFWFGAGSIGLDACLCQMFLIHCFATVESGIFLAMAFDRYVAI
CNPLRHSMVLTQTVVGRLGLAALLRGVLYIGPLPLMIRLRLPLYKTRVISHSYCEHMAVVALTCGDSRVNNVYGLSIGFLVLILDSVAIAASYVMIFRAVMGLATPEARLKTLGTCGSHICAILIFYV
PIAVSSLIHRFGHQVPPPIHTLLANFYLLIPPILNPIVYAVRTKQIRDRLLQILKTGTKIR

hide sequence

Ensembl Acc Id:

ENSRNOP00000024945 ⟸ ENSRNOT00000024945

Ensembl Acc Id:

ENSRNOP00000024948 ⟸ ENSRNOT00000024948

Protein Domains

G-protein coupled receptors family 1 profile

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-58233	BioCyc
Ensembl Genes	ENSRNOG00000018497	Ensembl
	ENSRNOG00000070164	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024948	ENTREZGENE
	ENSRNOT00000024948.5	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
	Olfactory_rcpt	UniProtKB/TrEMBL
KEGG Report	rno:293188	UniProtKB/TrEMBL
NCBI Gene	293188	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR 52M1	UniProtKB/TrEMBL
	OLFACTORY RECEPTOR 56B1-RELATED	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or52m1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018497	RatGTEx
	ENSRNOG00000070164	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A6I754	ENTREZGENE, UniProtKB/TrEMBL
	D4ACV2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or52m1	olfactory receptor family 52 subfamily M member 1	Olr48	olfactory receptor 48	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr48	olfactory receptor 48	Olr48_predicted	olfactory receptor 48 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr48_predicted	olfactory receptor 48 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype