Advanced Search (OLGA)

Gene: Or8j3 (olfactory receptor family 8 subfamily J member 3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Or8j3

Name:

olfactory receptor family 8 subfamily J member 3

RGD ID:

1333455

Description:

Predicted to enable G protein-coupled receptor activity and olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in plasma membrane. Orthologous to several human genes including OR8J3 (olfactory receptor family 8 subfamily J member 3); INTERACTS WITH bisphenol A; cadmium dichloride; copper atom.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

LOC100912463; olfactory receptor 484; olfactory receptor 8J3-like; olfactory receptor gene Olr484; olfactory receptor Olr484; Olr484

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	91,611,464 - 91,612,411 (-)	NCBI		GRCr8
mRatBN7.2	3	71,241,345 - 71,242,292 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	71,240,725 - 71,245,983 (-)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	3	71,204,184 - 71,209,420 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	74,589,749 - 74,590,696 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	83,188,287 - 83,189,234 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	80,972,343 - 80,973,290 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	73,522,096 - 73,523,043 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	73,522,096 - 73,523,043 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	80,091,316 - 80,092,263 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	69,378,937 - 69,379,884 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	69,275,308 - 69,276,256 (-)	NCBI
Celera	3	70,534,942 - 70,535,889 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or8j3	Rat	intellectual disability		ISO	OR8J3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or8j3	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Or8j3 (Mus musculus)	6480464	Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to OR8J3 promoter]	CTD	PMID:19654925
Or8j3	Rat	benzo[a]pyrene	affects methylation	ISO	OR8J3 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of OR8J3 promoter	CTD	PMID:27901495
Or8j3	Rat	benzo[a]pyrene	decreases methylation	ISO	OR8J3 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of OR8J3 exon	CTD	PMID:27901495
Or8j3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of OR8J3 mRNA	CTD	PMID:25181051
Or8j3	Rat	cadmium dichloride	increases methylation	EXP		6480464	Cadmium Chloride results in increased methylation of OR8J3 promoter	CTD	PMID:22457795
Or8j3	Rat	copper atom	multiple interactions	EXP		6480464	[Copper co-treated with Dietary Sucrose] results in increased expression of OR8J3 mRNA	CTD	PMID:26033743
Or8j3	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of OR8J3 mRNA	CTD	PMID:26033743
Or8j3	Rat	copper(0)	multiple interactions	EXP		6480464	[Copper co-treated with Dietary Sucrose] results in increased expression of OR8J3 mRNA	CTD	PMID:26033743
Or8j3	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of OR8J3 mRNA	CTD	PMID:26033743
Or8j3	Rat	fulvestrant	decreases methylation	ISO	OR8J3 (Homo sapiens)	6480464	Fulvestrant results in decreased methylation of OR8J3 gene	CTD	PMID:31601247
Or8j3	Rat	lead diacetate	increases expression	ISO	Or8j3 (Mus musculus)	6480464	lead acetate results in increased expression of OR8J3 mRNA	CTD	PMID:20542052
Or8j3	Rat	valproic acid	decreases methylation	ISO	OR8J3 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of OR8J3 gene	CTD	PMID:29154799
Or8j3	Rat	valproic acid	affects expression	ISO	Or8j3 (Mus musculus)	6480464	Valproic Acid affects the expression of OR8J3 mRNA	CTD	PMID:17963808

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or8j3	Rat	detection of chemical stimulus involved in sensory perception of smell	involved_in	IEA	GO:0004984	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Or8j3	Rat	detection of chemical stimulus involved in sensory perception of smell		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or8j3	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or8j3	Rat	G protein-coupled receptor signaling pathway		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or8j3	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276 and InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or8j3	Rat	sensory perception of smell	involved_in	IEA	UniProtKB-KW:KW-0552	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or8j3	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or8j3	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or8j3	Rat	membrane	located_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or8j3	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Or8j3	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or8j3	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or8j3	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or8j3	Rat	olfactory receptor activity	enables	IEA	InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or8j3	Rat	olfactory receptor activity		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or8j3	Rat	taste/olfaction phenotype		IEA		1303377		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Or8j3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	91,611,464 - 91,612,411 (-)	NCBI		GRCr8
mRatBN7.2	3	71,241,345 - 71,242,292 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	71,240,725 - 71,245,983 (-)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	3	71,204,184 - 71,209,420 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	74,589,749 - 74,590,696 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	83,188,287 - 83,189,234 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	80,972,343 - 80,973,290 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	73,522,096 - 73,523,043 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	73,522,096 - 73,523,043 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	80,091,316 - 80,092,263 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	69,378,937 - 69,379,884 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	69,275,308 - 69,276,256 (-)	NCBI
Celera	3	70,534,942 - 70,535,889 (-)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

OR8J3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	56,134,721 - 56,140,201 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	56,134,721 - 56,140,201 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	55,902,197 - 55,907,677 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	55,660,823 - 55,661,770 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	55,660,822 - 55,661,770	NCBI
Celera	11	53,244,400 - 53,245,347 (-)	NCBI		Celera
Cytogenetic Map	11	q12.1	NCBI
HuRef	11	52,233,228 - 52,234,175 (-)	NCBI		HuRef
CHM1_1	11	55,769,744 - 55,770,691 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	56,073,057 - 56,078,534 (-)	NCBI		T2T-CHM13v2.0

Or8j3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	86,028,147 - 86,029,094 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	86,026,254 - 86,033,353 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	86,197,803 - 86,198,750 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	86,195,910 - 86,203,009 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	86,037,960 - 86,038,907 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	85,998,642 - 85,999,589 (-)	NCBI		MGSCv36	mm8
Celera	2	87,776,584 - 87,777,531 (-)	NCBI		Celera
Cytogenetic Map	2	D	NCBI

LOC100972109
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	57,295,709 - 57,301,178 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	58,311,230 - 58,316,702 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	51,381,036 - 51,382,056 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

OR8J3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	39,543,985 - 39,544,914 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	39,543,985 - 39,544,914 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	39,089,661 - 39,090,590 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	40,221,465 - 40,222,394 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	40,221,465 - 40,222,394 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	39,826,034 - 39,826,963 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	39,393,337 - 39,394,266 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	39,976,434 - 39,977,363 (-)	NCBI		UU_Cfam_GSD_1.0

Predicted Target Of

	Summary Value
Count of predictions:	104
Count of miRNA genes:	47
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000012899, ENSRNOT00000012959
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
2302055	Pia30	Pristane induced arthritis QTL 30	3.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	3	27936919	72936919	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	28468571	73468571	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	28468571	73468571	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	28249687	73249687	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	61134348	89115068	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	28249687	73249687	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	30684642	75684642	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	28249687	73249687	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	28249687	73249687	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	28249687	73249687	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat

UniSTS:489494

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	3	91,611,464 - 91,612,411 (+)	Marker Load Pipeline
mRatBN7.2	3	71,241,344 - 71,242,292 (+)	MAPPER	mRatBN7.2
mRatBN7.2	3	71,204,800 - 71,205,748 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	73,522,096 - 73,523,043	NCBI	Rnor6.0
Rnor_5.0	3	80,179,896 - 80,180,843	UniSTS	Rnor5.0
Rnor_5.0	3	80,091,316 - 80,092,263	UniSTS	Rnor5.0
RGSC_v3.4	3	69,378,937 - 69,379,884	UniSTS	RGSC3.4
Celera	3	70,534,942 - 70,535,889	UniSTS
Cytogenetic Map	3	q24	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

ectoderm	endocrine system	endoderm	exocrine system	hepatobiliary system	mesenchyme	mesoderm	nervous system
1	1	1	1	1	2	1	1


RefSeq Transcripts	NM_001000306	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098337	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012959 ⟹ ENSRNOP00000063985

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	71,204,332 - 71,209,420 (-)	Ensembl
Rnor_6.0 Ensembl	3	73,522,096 - 73,523,043 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097228 ⟹ ENSRNOP00000091921

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	71,240,725 - 71,243,718 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103276 ⟹ ENSRNOP00000079469

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	71,240,725 - 71,245,983 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000120139 ⟹ ENSRNOP00000079942

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	71,204,184 - 71,207,068 (-)	Ensembl

RefSeq Acc Id:

NM_001000306 ⟹ NP_001000306

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	91,611,464 - 91,612,411 (-)	NCBI
mRatBN7.2	3	71,241,345 - 71,242,292 (-)	NCBI
Rnor_6.0	3	73,522,096 - 73,523,043 (-)	NCBI
Rnor_5.0	3	80,091,316 - 80,092,263 (-)	NCBI
RGSC_v3.4	3	69,378,937 - 69,379,884 (-)	RGD
Celera	3	70,534,942 - 70,535,889 (-)	RGD

Sequence:

show sequence

ATGGCTCCTAGAAATTTATCTCATATCACTGAATTCATTCTTGTGGGAGTTTCAGACCTTCCAGAACTTCAGGTTCCACTTTTCTTTGTCTTCCTAATCATCTACCTTCTGACAGCAGCGGGGAACCT
GGGCATCATCACCCTCACCACCGTGGACTCACGACTGCAAACACCCATGTACTTCTTCCTCAGACACCTGGCGGTCATCAACTTCGGCAACTCAACTGTCATTGCTCCTAAAATGCTGGTCAACTTCT
TAGTCACAGAGAAAACTACCTTATACTATGAATGTGCCACGCAGTTAGGAGGATTCCTGGTTTTCATTGTAGCAGAGATCTTCATGCTCGCTGTGATGGCCTATGACCGCTATGTGGCCATCTGCAAC
CCACTGCTCTATATGGTGGTGGTGTCTCGACGCGTCTGCCTTCTGCTCATGTCCTTAACATACTTCTATGGCTTTTGCACAGCCATTGTTGTTTCATCATGTGTGTTCTCTGTGTCTTATTGCTCCTC
CAAGAAAATCAACCATTTTTACTGTGATAATGTCCCTCTCTTAGCACTTTCCTGTTCTGACACCTACCTTCCAGAAACTGTAGTCTTTATATCTGCAGCTACAAACTTGTTCTTTTCCATGAGTATAG
TGCTGGTATCTTATTTCAATATTGTGTTGTCTATCCTAAGGATCCGTTCATCAGAAGGAAGGAAAAAAGCCTTTTCCACCTGTGCTTCACATATGATGGCTGTCACAGTTTTCTATGGGACACTGCTG
TTTATGTATTTGCAACCTCAGACTAACCACTCACTAGATACTGATAAGATGGCCTCTGTGTTTTATACATTGGTGATACCAATGCTGAACCCCATGATCTACAGCCTGAGGAACAAGGACGTGAAGGC
CGCTTTAAAGAAATTCATTACAAATCCATGTGATTCTTTCAAATCACTGTAA

hide sequence


Protein RefSeqs	NP_001000306	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL79364	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000063985
	ENSRNOP00000063985.1
	ENSRNOP00000079469.1
	ENSRNOP00000079942.1
	ENSRNOP00000091921.1

RefSeq Acc Id:

NP_001000306 ⟸ NM_001000306

- UniProtKB:

D3ZA98 (UniProtKB/TrEMBL), A6HMW3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAPRNLSHITEFILVGVSDLPELQVPLFFVFLIIYLLTAAGNLGIITLTTVDSRLQTPMYFFLRHLAVINFGNSTVIAPKMLVNFLVTEKTTLYYECATQLGGFLVFIVAEIFMLAVMAYDRYVAICN
PLLYMVVVSRRVCLLLMSLTYFYGFCTAIVVSSCVFSVSYCSSKKINHFYCDNVPLLALSCSDTYLPETVVFISAATNLFFSMSIVLVSYFNIVLSILRIRSSEGRKKAFSTCASHMMAVTVFYGTLL
FMYLQPQTNHSLDTDKMASVFYTLVIPMLNPMIYSLRNKDVKAALKKFITNPCDSFKSL

hide sequence

Ensembl Acc Id:

ENSRNOP00000063985 ⟸ ENSRNOT00000012959

Ensembl Acc Id:

ENSRNOP00000091921 ⟸ ENSRNOT00000097228

Ensembl Acc Id:

ENSRNOP00000079469 ⟸ ENSRNOT00000103276

Ensembl Acc Id:

ENSRNOP00000079942 ⟸ ENSRNOT00000120139

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZA98-F1-model_v2	AlphaFold	D3ZA98	1-315	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-49074	BioCyc
Ensembl Genes	ENSRNOG00000045807	Ensembl
	ENSRNOG00000066809	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOG00000067142	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000012959	ENTREZGENE
	ENSRNOT00000012959.4	UniProtKB/TrEMBL
	ENSRNOT00000097228.1	UniProtKB/TrEMBL
	ENSRNOT00000103276.1	UniProtKB/TrEMBL
	ENSRNOT00000120139.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
KEGG Report	rno:295750	UniProtKB/TrEMBL
NCBI Gene	295750	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or8j3	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000045807	RatGTEx
	ENSRNOG00000066809	RatGTEx
	ENSRNOG00000067142	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A6HMW3	ENTREZGENE, UniProtKB/TrEMBL
	D3ZA98	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or8j3	olfactory receptor family 8 subfamily J member 3	Olr484	olfactory receptor 484	Symbol and Name Changed	1299863	APPROVED
2015-07-29	Olr484	olfactory receptor 484	LOC100912463	olfactory receptor 8J3-like	Data merged from RGD:6487151	737654	PROVISIONAL
2012-07-05	LOC100912463	olfactory receptor 8J3-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-04-30	Olr484	olfactory receptor 484	Olr484_predicted	olfactory receptor 484 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr484_predicted	olfactory receptor 484 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype