Advanced Search (OLGA)

Gene: Or13c7 (olfactory receptor family 13 subfamily C member 7) Rattus norvegicus

Analyze

Symbol:

Or13c7

Name:

olfactory receptor family 13 subfamily C member 7

RGD ID:

1333374

Description:

Predicted to enable G protein-coupled receptor activity and olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in nucleoplasm and plasma membrane. Orthologous to human OR2S2 (olfactory receptor family 2 subfamily S member 2); INTERACTS WITH bisphenol A; copper(II) sulfate (ortholog); crocidolite asbestos (ortholog).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 840; olfactory receptor gene Olr840; olfactory receptor Olr840; Olr840

RGD Orthologs

Human

Mouse

Green Monkey

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	OR2S2 (olfactory receptor family 2 subfamily S member 2)	HGNC	Ensembl, HomoloGene, OrthoDB
Mus musculus (house mouse):	Or13c7 (olfactory receptor family 13 subfamily C member 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	OR2S2 (olfactory receptor family 2 subfamily S member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	OR2S2 (olfactory receptor family 2 subfamily S member 2)	Alliance	DIOPT (HGNC)
Homo sapiens (human):	OR13C7 (olfactory receptor family 13 subfamily C member 7 (gene/pseudogene))	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Mus musculus (house mouse):	Or13c7 (olfactory receptor family 13 subfamily C member 7)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-26	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-31	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-32	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-28	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-27	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-37	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-33	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-36	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-38	Alliance	DIOPT (InParanoid\|SonicParanoid)
Caenorhabditis elegans (roundworm):	srsx-35	Alliance	DIOPT (InParanoid\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	62,876,908 - 62,877,867 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	62,876,908 - 62,877,867 (+)	Ensembl				GRCr8
mRatBN7.2	5	58,081,150 - 58,082,109 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	58,077,726 - 58,083,852 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	60,061,728 - 60,062,687 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	61,880,539 - 61,881,498 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	61,851,247 - 61,852,206 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	59,326,803 - 59,327,762 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	59,326,803 - 59,327,762 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	63,850,377 - 63,851,336 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	60,315,547 - 60,316,506 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	56,659,602 - 56,660,561 (+)	NCBI		Celera
RGSC_v3.1	5	60,315,725 - 60,316,685 (+)	NCBI
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

bisphenol A (EXP,ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

fulvestrant (ISO)

resveratrol (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IEA)

sensory perception of smell (IEA)

signal transduction (IEA)

Cellular Component

membrane (IEA)

nucleoplasm (IEA)

plasma membrane (IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

olfactory receptor activity (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Or13c7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	62,876,908 - 62,877,867 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	62,876,908 - 62,877,867 (+)	Ensembl				GRCr8
mRatBN7.2	5	58,081,150 - 58,082,109 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	58,077,726 - 58,083,852 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	60,061,728 - 60,062,687 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	61,880,539 - 61,881,498 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	61,851,247 - 61,852,206 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	59,326,803 - 59,327,762 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	59,326,803 - 59,327,762 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	63,850,377 - 63,851,336 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	60,315,547 - 60,316,506 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	56,659,602 - 56,660,561 (+)	NCBI		Celera
RGSC_v3.1	5	60,315,725 - 60,316,685 (+)	NCBI
Cytogenetic Map	5	q22	NCBI

OR2S2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	35,957,108 - 35,958,154 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	35,957,108 - 35,958,154 (-)	Ensembl			hg38	GRCh38
GRCh37	9	35,957,105 - 35,958,151 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	35,947,136 - 35,948,065 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	9	35,947,135 - 35,948,065	NCBI
Celera	9	35,890,670 - 35,891,716 (-)	NCBI		Celera
Cytogenetic Map	9	p13.3	NCBI
HuRef	9	35,910,882 - 35,911,928 (-)	NCBI		HuRef
CHM1_1	9	35,957,360 - 35,958,406 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	35,978,781 - 35,979,827 (-)	NCBI		T2T-CHM13v2.0

Or13c7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	43,854,292 - 43,855,463 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	43,851,565 - 43,857,595 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	43,854,292 - 43,855,463 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	43,851,565 - 43,857,595 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	43,867,164 - 43,868,335 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	43,875,392 - 43,876,563 (+)	NCBI		MGSCv36	mm8
Celera	4	43,879,160 - 43,880,331 (+)	NCBI		Celera
Cytogenetic Map	4	B1	NCBI
cM Map	4	23.05	NCBI

OR2S2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	44,641,428 - 44,644,610 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	44,642,833 - 44,643,792 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	41,745,950 - 41,747,121 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Or13c7
3 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	83
Count of miRNA genes:	71
Interacting mature miRNAs:	72
Transcripts:	ENSRNOT00000052426
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	32751649	77751649	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	38011670	83011670	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	52665372	94894052	Rat
6907115	Mcs29	Mammary carcinoma susceptibility QTL 29			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	38004331	83004331	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	23671493	79046465	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	38011670	83011670	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	38011670	83011670	Rat
1331782	Rf36	Renal function QTL 36	3.296		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	39019942	102105896	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	33311673	78311673	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	32751649	77751649	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	39985948	84985948	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	6922282	81330203	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33311673	78311673	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	39526924	84526924	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	48523123	91770353	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	91770353	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	60511627	105511627	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	7065535	74335773	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	10019064	87027358	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	26023211	71023211	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	56546393	101546393	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	23671493	68671493	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	hemolymphoid system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
1	1	5	2	4	1	1	10	3	3	6	11	4

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001000414	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC133832	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000050490 ⟹ ENSRNOP00000040530

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	58,077,726 - 58,083,852 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000052426 ⟹ ENSRNOP00000041214

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	59,326,803 - 59,327,762 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105443 ⟹ ENSRNOP00000078287

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	58,077,906 - 58,083,852 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118679 ⟹ ENSRNOP00000093951

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	62,876,908 - 62,877,867 (+)	Ensembl

RefSeq Acc Id:

NM_001000414 ⟹ NP_001000414

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	62,876,908 - 62,877,867 (+)	NCBI
mRatBN7.2	5	58,081,150 - 58,082,109 (+)	NCBI
Rnor_6.0	5	59,326,803 - 59,327,762 (+)	NCBI
Rnor_5.0	5	63,850,377 - 63,851,336 (+)	NCBI
RGSC_v3.4	5	60,315,547 - 60,316,506 (+)	RGD
Celera	5	56,659,602 - 56,660,561 (+)	RGD

Sequence:

show sequence

ATGGACAGGTTCAATGAGACCTCCCCCGTATCCCACTTCATTCTCCTGGGCCTCTCCGCCCACC
CAAGGCTGGAGAAAACCTTCTTCGTGCTCATCCTGCTGATGTACCTGGTGATCCTGCTGGGCAA
CGGGGTCCTTATCCTGGTGACCATCCTCGACTCCCACCTGCACACGCCCATGTACTTCTTCCTG
AGGAACCTCTCCTTCCTGGACATCTGCTACACCACCTCCTCGGTCCCCCTCATTCTGGACAGCT
TCCTGACCCCCAGGAAGACCATCTCCCTCTCAGGCTGTGCCGTGCAGATGTTTCTGTCCTTCGC
CATGGGAGCCACGGAGTGTGTGCTTCTGAGCATGATGGCGTTTGATCGCTATGTGGCCATCTGC
AACCCCCTTAGGTACCCAGTGGTCATGAGCAAGGCTGCCTATGTGCCCATGGCCGCCGGCTCCT
GGGCAGGTGGTATCACCAATTCTGTAGTTCAGACATCTTTGGCAATGAGGCTGCCGTTCTGTGG
GGACAATGTCATCAACCACTTCACCTGTGAGATCCTGGCTGTCCTGAAACTGGCCTGTGCTGAC
ATCTCCATCAATATCATCAGCATGGGGGTGGCCAACGTGATCTTCCTGGGGGTCCCAGTTCTGT
TCATCTTTGTCTCCTACATCTTTATCCTCTCCACCATCCTGAGGATCCCCTCTGCTGAGGGGAG
GAAGAAGGCCTTCTCCACCTGCTCTGCCCACCTCACCGTGGTGATTGTCTTCTATGGGACCATC
CTCTTCATGTACGGGAAGCCCAAGTCCAAGGACCCACTGGGGGCAGACAAGCAGGACCTTGCAG
ACAAGCTCATCTCCCTCTTCTATGGGGTGGTGACCCCCATGTTGAACCCCATCATCTACAGCCT
GAGGAACAAGGATGTGAGGGCTGCTGTGAGGAACCTGGTGGTTCAGAAACACCTAACTGAGTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001000414	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL98777	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000093951

RefSeq Acc Id:

NP_001000414 ⟸ NM_001000414

- UniProtKB:

D4AA28 (UniProtKB/TrEMBL), A6IJ57 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDRFNETSPVSHFILLGLSAHPRLEKTFFVLILLMYLVILLGNGVLILVTILDSHLHTPMYFFL
RNLSFLDICYTTSSVPLILDSFLTPRKTISLSGCAVQMFLSFAMGATECVLLSMMAFDRYVAIC
NPLRYPVVMSKAAYVPMAAGSWAGGITNSVVQTSLAMRLPFCGDNVINHFTCEILAVLKLACAD
ISINIISMGVANVIFLGVPVLFIFVSYIFILSTILRIPSAEGRKKAFSTCSAHLTVVIVFYGTI
LFMYGKPKSKDPLGADKQDLADKLISLFYGVVTPMLNPIIYSLRNKDVRAAVRNLVVQKHLTE

hide sequence

Ensembl Acc Id:

ENSRNOP00000041214 ⟸ ENSRNOT00000052426

Ensembl Acc Id:

ENSRNOP00000040530 ⟸ ENSRNOT00000050490

Ensembl Acc Id:

ENSRNOP00000078287 ⟸ ENSRNOT00000105443

Ensembl Acc Id:

ENSRNOP00000093951 ⟸ ENSRNOT00000118679

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZLK0-F1-model_v2	AlphaFold	D3ZLK0	1-319	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1333374	AgrOrtholog
BioCyc Gene	G2FUF-41483	BioCyc
Ensembl Genes	ENSRNOG00000030761	Ensembl
	ENSRNOG00000068857	Ensembl
	ENSRNOG00000080628	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000118679	ENTREZGENE
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
KEGG Report	rno:298733	UniProtKB/TrEMBL
NCBI Gene	298733	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or13c7	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000030761	RatGTEx
	ENSRNOG00000068857	RatGTEx
	ENSRNOG00000080628	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A6IJ57	ENTREZGENE, UniProtKB/TrEMBL
	D4AA28	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or13c7	olfactory receptor family 13 subfamily C member 7	Olr840	olfactory receptor 840	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr840	olfactory receptor 840	Olr840_predicted	olfactory receptor 840 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr840_predicted	olfactory receptor 840 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Mammalian Phenotype