Advanced Search (OLGA)

Gene: Or6ae1 (olfactory receptor family 6 subfamily A member E1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Or6ae1

Name:

olfactory receptor family 6 subfamily A member E1

RGD ID:

1333221

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception of smell. Predicted to be active in plasma membrane. Orthologous to human OR6Q1 (olfactory receptor family 6 subfamily Q member 1); INTERACTS WITH bisphenol A; copper atom; copper(0).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 286; olfactory receptor gene Olr286; olfactory receptor Olr286; Olr286

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	204,386,790 - 204,387,728 (-)	NCBI		GRCr8
mRatBN7.2	1	194,957,151 - 194,958,089 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	194,957,151 - 194,958,089 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	203,318,079 - 203,319,017 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	210,447,555 - 210,448,493 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	203,121,394 - 203,122,332 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	212,632,366 - 212,633,304 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	212,632,366 - 212,633,304 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	219,547,270 - 219,548,208 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	199,965,626 - 199,966,564 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	200,115,617 - 200,116,556 (-)	NCBI
Celera	1	192,634,442 - 192,635,380 (-)	NCBI		Celera
Cytogenetic Map	1	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or6ae1	Rat	intellectual disability		ISO	OR6Q1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or6ae1	Rat	1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene	multiple interactions	ISO	Or6ae1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Or6ae1	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	Or6ae1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Or6ae1	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	Or6ae1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Or6ae1	Rat	2,4,4'-trichlorobiphenyl	multiple interactions	ISO	Or6ae1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Or6ae1	Rat	2-palmitoylglycerol	increases expression	ISO	OR6Q1 (Homo sapiens)	6480464	2-palmitoylglycerol results in increased expression of OR6Q1 mRNA	CTD	PMID:37199045
Or6ae1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of OR6AE1 mRNA and bisphenol A results in decreased expression of OR6Q1 mRNA	CTD	PMID:25181051
Or6ae1	Rat	bisphenol A	decreases methylation	ISO	Or6ae1 (Mus musculus)	6480464	bisphenol A results in decreased methylation of OR6AE1 promoter	CTD	PMID:27312807
Or6ae1	Rat	CGP 52608	multiple interactions	ISO	OR6Q1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to OR6Q1 gene]	CTD	PMID:28238834
Or6ae1	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of OR6AE1 mRNA	CTD	PMID:26033743
Or6ae1	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of OR6AE1 mRNA	CTD	PMID:26033743
Or6ae1	Rat	PCB138	multiple interactions	ISO	Or6ae1 (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Or6ae1	Rat	resveratrol	multiple interactions	ISO	OR6Q1 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of OR6Q1 mRNA	CTD	PMID:23557933

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or6ae1	Rat	detection of chemical stimulus involved in sensory perception of smell	involved_in	IBA	MGI:106182 and PANTHER:PTN002818000	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or6ae1	Rat	detection of chemical stimulus involved in sensory perception of smell		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or6ae1	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or6ae1	Rat	G protein-coupled receptor signaling pathway		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or6ae1	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276 and InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or6ae1	Rat	sensory perception of smell	involved_in	IEA	UniProtKB-KW:KW-0552	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or6ae1	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or6ae1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or6ae1	Rat	membrane	located_in	IEA	InterPro:IPR000276 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or6ae1	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Or6ae1	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or6ae1	Rat	plasma membrane	is_active_in	IBA	MGI:106648 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or6ae1	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Or6ae1	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Or6ae1	Rat	olfactory receptor activity	enables	IBA	MGI:106182 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Or6ae1	Rat	olfactory receptor activity		IEA	(All species)	1303377	CREATED_DATE field changed to comply with GOC standards. Original CREATED_DATE: 2005-02-17	RGD
Or6ae1	Rat	olfactory receptor activity	enables	IEA	InterPro:IPR000725	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Or6ae1	Rat	taste/olfaction phenotype		IEA		1303377		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Or6ae1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	204,386,790 - 204,387,728 (-)	NCBI		GRCr8
mRatBN7.2	1	194,957,151 - 194,958,089 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	194,957,151 - 194,958,089 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	203,318,079 - 203,319,017 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	210,447,555 - 210,448,493 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	203,121,394 - 203,122,332 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	212,632,366 - 212,633,304 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	212,632,366 - 212,633,304 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	219,547,270 - 219,548,208 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	199,965,626 - 199,966,564 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	200,115,617 - 200,116,556 (-)	NCBI
Celera	1	192,634,442 - 192,635,380 (-)	NCBI		Celera
Cytogenetic Map	1	q41	NCBI

OR6Q1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	58,030,953 - 58,031,906 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	58,030,953 - 58,031,906 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	57,798,425 - 57,799,378 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	57,555,001 - 57,555,954 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	57,555,000 - 57,555,954	NCBI
Celera	11	55,155,488 - 55,156,441 (+)	NCBI		Celera
Cytogenetic Map	11	q12.1	NCBI
HuRef	11	54,147,791 - 54,148,744 (+)	NCBI		HuRef
CHM1_1	11	57,665,494 - 57,666,447 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	57,981,302 - 57,982,255 (+)	NCBI		T2T-CHM13v2.0

Or6ae1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	139,741,923 - 139,742,861 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	139,739,912 - 139,744,677 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	140,162,010 - 140,162,948 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	140,159,999 - 140,164,764 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	147,347,909 - 147,348,847 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	140,013,330 - 140,014,268 (-)	NCBI		MGSCv36	mm8
Celera	7	139,960,491 - 139,961,429 (-)	NCBI		Celera
Cytogenetic Map	7	F4	NCBI
cM Map	7	85.19	NCBI

LOC102024938
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955511	2,822,503 - 2,823,456 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955511	2,822,493 - 2,823,456 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100985834
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	59,186,088 - 59,187,811 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	60,212,245 - 60,213,968 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	53,276,707 - 53,277,809 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	56,739,807 - 56,740,796 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	56,739,824 - 56,740,777 (+)	Ensembl	panpan1.1		panPan2

OR6Q1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	38,284,202 - 38,285,308 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	38,284,202 - 38,285,155 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	37,828,196 - 37,829,149 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	38,963,125 - 38,964,078 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	38,963,125 - 38,964,078 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	38,546,406 - 38,547,359 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	38,119,488 - 38,120,441 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	38,746,695 - 38,747,648 (-)	NCBI		UU_Cfam_GSD_1.0

LOC101966731
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	14,497,584 - 14,500,007 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936581	4,612,582 - 4,613,535 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936581	4,612,560 - 4,613,546 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100620717
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	14	141,393,083 - 141,394,018 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	153,707,013 - 153,747,628 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103235225
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	15,203,972 - 15,205,461 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	15,204,089 - 15,205,273 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	112,515,126 - 112,516,345 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

LOC101717541
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624864	2,820,035 - 2,827,700 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Or6ae1
10 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	107
Count of miRNA genes:	72
Interacting mature miRNAs:	76
Transcripts:	ENSRNOT00000025611
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
1354653	Despr9	Despair related QTL 9		0.00019	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	167909849	212909849	Rat
2293673	Bss27	Bone structure and strength QTL 27	18.63	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	1	171629477	216629477	Rat
2293677	Bss41	Bone structure and strength QTL 41	9.38	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	1	171629477	216629477	Rat
1302787	Stl25	Serum triglyceride level QTL 25	2.7	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	180359209	210702199	Rat
70160	Bw18	Body weight QTL 18	5.7		body mass (VT:0001259)	body weight (CMO:0000012)	1	144267353	196383668	Rat
1549830	Bss1	Bone structure and strength QTL 1	4.8		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	172609619	217609619	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
70163	Bw20	Body weight QTL 20	5.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	174133260	219133260	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1558658	Bw59	Body weight QTL 59	3.5	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	1	178784622	223784622	Rat
631838	Niddm36	Non-insulin dependent diabetes mellitus QTL 36		0.01	insulin secretion trait (VT:0003564)	calculated pancreatic islet insulin release measurement (CMO:0001217)	1	184550676	229550676	Rat
1354636	Lmblg1	Limb length QTL 1	6.4		tibia length (VT:0004357)	tibia length (CMO:0000450)	1	151162512	201278233	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
2293689	Bss47	Bone structure and strength QTL 47	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	1	171629477	216629477	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1598853	Memor3	Memory QTL 3	4.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	1	143506580	212458660	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	169537671	214537671	Rat
1354634	Kidm12	Kidney mass QTL 12	3.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	1	151162512	201278233	Rat
4889428	Stresp24	Stress response QTL 24		0.05	heart pumping trait (VT:2000009)	absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162)	1	155866514	200866514	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	117917486	196963478	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
61343	Bp28	Blood pressure QTL 28			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	151646613	196646613	Rat
2293693	Bss22	Bone structure and strength QTL 22	33.52	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	1	171629477	216629477	Rat
2300161	Bmd43	Bone mineral density QTL 43	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
1300145	Rf7	Renal function QTL 7	2.96		urine creatinine amount (VT:0010540)	urine creatinine level (CMO:0000125)	1	185145134	221264292	Rat
61347	Bp197	Blood pressure QTL 197	4.2		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	1	158633083	203633083	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
61348	Bp30	Blood pressure QTL 30	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	144017057	197814409	Rat
2303622	Vencon6	Ventilatory control QTL 6		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	1	154561505	199561505	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631214	Bw61	Body weight QTL61	3.4	0.0001	intramuscular adipose amount (VT:0010044)	intramuscular fat area (CMO:0001162)	1	173108781	218108781	Rat
7771612	Cm80	Cardiac mass QTL 80	8.4		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	1	149448574	221264292	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
2300174	Bmd42	Bone mineral density QTL 42	8.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	1	171629477	216629477	Rat
737828	Hcas3	Hepatocarcinoma susceptibility QTL 3	4.9		liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	1	144267353	222987745	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1358886	Bp260	Blood pressure QTL 260	3.67		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	151162766	225824951	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	181133855	226133855	Rat
2293654	Bss30	Bone structure and strength QTL 30	32.65	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	1	171629477	216629477	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
2300187	Bmd41	Bone mineral density QTL 41	8.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	171629477	216629477	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
1359018	Hrtrt20	Heart rate QTL 20	3.08		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	185356336	202902618	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
634312	Bp143	Blood pressure QTL 143	3	0.0002	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	182623426	219932796	Rat
1358294	Bw37	Body weight QTL 37	5	0.000011	body mass (VT:0001259)	body weight (CMO:0000012)	1	171310381	216310381	Rat
61378	Bp43	Blood pressure QTL 43	22.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	181746937	196383668	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
724559	Pancm1	Pancreatic morphology QTL 1	7.1		islet of Langerhans morphology trait (VT:0005215)	pancreatic islet damage composite score (CMO:0001156)	1	181759564	214537555	Rat
2312420	Pur17	Proteinuria QTL 17	7.1	0.0001	urine protein amount (VT:0005160)	urine total protein excretion rate (CMO:0000756)	1	156677124	218753816	Rat
10059600	Bp378	Blood pressure QTL 378	3.08	0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	176869060	221869060	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
619613	Bp77	Blood pressure QTL 77		0.01	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	164747424	209747424	Rat
631260	Tcas2	Tongue tumor susceptibility QTL 2	4.93		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	192485903	199050587	Rat
619614	Bp78	Blood pressure QTL 78		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	169112897	197261052	Rat
2312564	Glom18	Glomerulus QTL 18	2.4	0.003	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	1	185356336	231689108	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	169537671	214537671	Rat
2292222	Bp307	Blood pressure QTL 307	3.06	0.0014	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	213533942	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
1600380	Niddm70	Non-insulin dependent diabetes mellitus QTL 70	3.1	0.0008	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	176550523	221550523	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
1582206	Kidm33	Kidney mass QTL 33	6.9		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	188377360	224054420	Rat
1354620	Kidm19	Kidney mass QTL 19	4		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	201278233	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
634338	Hcar4	Hepatocarcinoma resistance QTL 4	4.6		liver integrity trait (VT:0010547)	liver tumorous lesion number to liver area ratio (CMO:0001210)	1	193422268	214537671	Rat
1354618	Kidm15	Kidney mass QTL 15	5		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	1	156677124	201278233	Rat
6903303	Scl34	Serum cholesterol QTL 34	2.5	0.0033	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	180359209	218108781	Rat
6480780	Insul18	Insulin level QTL 18	4.11		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	189607473	200611765	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	123556856	196963478	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
2293083	Iddm25	Insulin dependent diabetes mellitus QTL 25	4.18		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	181829673	224569684	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
1354602	Bw35	Body weight QTL 35	12.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	201278233	Rat
631670	Iddm10	Insulin dependent diabetes mellitus QTL 10	1.9		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	174133260	196383668	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	reproductive system
1	5	9	29	15	1	1	3	1	1	32	25	18	10


RefSeq Transcripts	NM_001000554	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC108564	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025611 ⟹ ENSRNOP00000025611

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	194,957,151 - 194,958,089 (-)	Ensembl
Rnor_6.0 Ensembl	1	212,632,366 - 212,633,304 (-)	Ensembl

RefSeq Acc Id:

NM_001000554 ⟹ NP_001000554

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	204,386,790 - 204,387,728 (-)	NCBI
mRatBN7.2	1	194,957,151 - 194,958,089 (-)	NCBI
Rnor_6.0	1	212,632,366 - 212,633,304 (-)	NCBI
Rnor_5.0	1	219,547,270 - 219,548,208 (-)	NCBI
RGSC_v3.4	1	199,965,626 - 199,966,564 (-)	RGD
Celera	1	192,634,442 - 192,635,380 (-)	RGD

Sequence:

show sequence

ATGAGCAACCGCAGCAACAACACTTTGGTGACGGAGTTCATTCTTCTGGGTTTCCCAGAGCTGCGCCACCTACAAGGGCTGTTATTTGGGTTATTCCTAATCATCTACGTGGTGACTGTCCTAGAGAA
CTTGGTCATCGTGGGCACCATAAGTGCTAGCCGGCAGCTACACATACCCATGTACTTTTTCCTGGCCAATCTGTCTGTGCTAGAGACCCTCTACACCACAGTCACAGTGCCCAAGCTGCTTGCTGGTC
TCCTAGCAGGGGCAAAAGCCATCTCCTTCTCAGGGTGCCTCACCCAGCTCTTCCTCTTTCTTTCACTGGGCTCCTCTGAGTGTTTCTTACTGTCCACCATGGCCTGTGACCGGTACCTGGCCATCTGC
CGCCCACTGCACTACCCAGCCATCATGGATTCAAAGCTGTGCCTGCATCTAGCTCTTAGTGCCTGGCTCGGGGGCTTCTTGGCCTCCTTTGTGTCCACAGCTCTCATCTCCCGCCTCAGTTTCTGTGG
CTCCAATGCCCTCAACCACTTCTTCTGTGACGTCTCACCGCTGTTGCAACTCTCCTGCACAGACACCACTGCCATTGAAATGCTGGACTTTGTGGCAGCTCTAGCAGTACTTGCAACCTCTCTGATAG
TGACCTCAGTCTCCTATGTCCACATCGTGGCCACTGTCCTGAGGATCCCAGGAGGGGCAGGCCGCAGGAGGGCCTTCTCTACCTGTGCCTCTCACTTGGTGGTGGTCTTAATCTTCTACACCACCACC
ACTTTCATGTATGCCCGGCCTCATGCCATAAGCTCCTTCGACCTCAACAAGCTGGTATCTGTGATTTACTCGGTAGTGACCCCCCTGCTGAACCCCATAATCTACTGCCTGAGGAACCGTGACATCAG
AGAGGCACTTACCAAACTCCTGCAGTCCCTCAGGTTCCCCTGA

hide sequence


Protein RefSeqs	NP_001000554	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM11909	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025611
	ENSRNOP00000025611.1

RefSeq Acc Id:

NP_001000554 ⟸ NM_001000554

- UniProtKB:

D3ZUL7 (UniProtKB/TrEMBL), A6HXH8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSNRSNNTLVTEFILLGFPELRHLQGLLFGLFLIIYVVTVLENLVIVGTISASRQLHIPMYFFLANLSVLETLYTTVTVPKLLAGLLAGAKAISFSGCLTQLFLFLSLGSSECFLLSTMACDRYLAIC
RPLHYPAIMDSKLCLHLALSAWLGGFLASFVSTALISRLSFCGSNALNHFFCDVSPLLQLSCTDTTAIEMLDFVAALAVLATSLIVTSVSYVHIVATVLRIPGGAGRRRAFSTCASHLVVVLIFYTTT
TFMYARPHAISSFDLNKLVSVIYSVVTPLLNPIIYCLRNRDIREALTKLLQSLRFP

hide sequence

Ensembl Acc Id:

ENSRNOP00000025611 ⟸ ENSRNOT00000025611

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZUL7-F1-model_v2	AlphaFold	D3ZUL7	1-312	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-57054	BioCyc
Ensembl Genes	ENSRNOG00000018955	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025611	ENTREZGENE
	ENSRNOT00000025611.3	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
	Olfactory_GPCR1	UniProtKB/TrEMBL
KEGG Report	rno:365384	UniProtKB/TrEMBL
NCBI Gene	365384	ENTREZGENE
PANTHER	G-PROTEIN COUPLED RECEPTOR	UniProtKB/TrEMBL
	ODORANT RECEPTOR-RELATED	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or6ae1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000018955	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A6HXH8	ENTREZGENE, UniProtKB/TrEMBL
	D3ZUL7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or6ae1	olfactory receptor family 6 subfamily A member E1	Olr286	olfactory receptor 286	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr286	olfactory receptor 286	Olr286_predicted	olfactory receptor 286 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr286_predicted	olfactory receptor 286 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Mammalian Phenotype