Symbol:
Siglec1
Name:
sialic acid binding Ig like lectin 1
RGD ID:
1311953
Description:
Predicted to enable virion binding activity. Predicted to be involved in clathrin-dependent endocytosis of virus by host cell; negative regulation of phagocytosis; and negative regulation of type I interferon production. Predicted to act upstream of or within positive regulation of T cell apoptotic process and positive regulation of extrinsic apoptotic signaling pathway. Predicted to be located in endocytic vesicle. Predicted to be active in early endosome; late endosome; and plasma membrane. Orthologous to human SIGLEC1 (sialic acid binding Ig like lectin 1); INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
sialic acid binding Ig-like lectin 1, sialoadhesin; sialoadhesin; Sn
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SIGLEC1 (sialic acid binding Ig like lectin 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Siglec1 (sialic acid binding Ig-like lectin 1, sialoadhesin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Siglec1 (sialic acid binding Ig like lectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SIGLEC1 (sialic acid binding Ig like lectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SIGLEC1 (sialic acid binding Ig like lectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Siglec1 (sialic acid binding Ig like lectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SIGLEC1 (sialic acid binding Ig like lectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SIGLEC1 (sialic acid binding Ig like lectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Siglec1 (sialic acid binding Ig like lectin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SIGLEC1 (sialic acid binding Ig like lectin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Siglec1 (sialic acid binding Ig-like lectin 1, sialoadhesin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
siglec1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 138,740,171 - 138,759,966 (-) NCBI GRCr8 mRatBN7.2 3 118,287,988 - 118,307,125 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 118,287,988 - 118,306,850 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 122,182,321 - 122,201,175 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 130,781,499 - 130,800,293 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 128,438,431 - 128,457,285 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 123,612,067 - 123,631,718 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 123,612,067 - 123,631,109 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 130,111,340 - 130,130,084 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 118,769,404 - 118,787,908 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 118,676,987 - 118,692,769 (-) NCBI Celera 3 117,098,468 - 117,117,016 (-) NCBI Celera Cytogenetic Map 3 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Siglec1 Rat 17beta-estradiol increases expression ISO Siglec1 (Mus musculus) 6480464 Estradiol results in increased expression of SIGLEC1 mRNA CTD PMID:19484750 Siglec1 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of SIGLEC1 mRNA CTD PMID:35192832 Siglec1 Rat 17beta-estradiol decreases expression ISO Siglec1 (Mus musculus) 6480464 Estradiol results in decreased expression of SIGLEC1 mRNA CTD PMID:39298647 Siglec1 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of SIGLEC1 mRNA CTD PMID:32741896 Siglec1 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of SIGLEC1 mRNA CTD PMID:32741896 Siglec1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Siglec1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SIGLEC1 mRNA CTD PMID:28922406 Siglec1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SIGLEC1 mRNA CTD PMID:34747641 Siglec1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SIGLEC1 mRNA CTD PMID:32109520 Siglec1 Rat 4,4'-sulfonyldiphenol increases expression ISO Siglec1 (Mus musculus) 6480464 bisphenol S results in increased expression of SIGLEC1 mRNA CTD PMID:30951980 Siglec1 Rat 4,4'-sulfonyldiphenol affects expression ISO Siglec1 (Mus musculus) 6480464 bisphenol S affects the expression of SIGLEC1 mRNA CTD PMID:39298647 Siglec1 Rat 5-fluorouracil multiple interactions ISO SIGLEC1 (Homo sapiens) 6480464 [Fluorouracil co-treated with irinotecan] results in increased expression of SIGLEC1 mRNA CTD PMID:16391804 Siglec1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of SIGLEC1 mRNA CTD PMID:30047161 Siglec1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of SIGLEC1 mRNA CTD PMID:31881176 Siglec1 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of SIGLEC1 mRNA CTD PMID:33354967 Siglec1 Rat aldehydo-D-glucose multiple interactions ISO Siglec1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of SIGLEC1 mRNA CTD PMID:37567420 Siglec1 Rat all-trans-retinoic acid increases expression ISO SIGLEC1 (Homo sapiens) 6480464 Tretinoin results in increased expression of SIGLEC1 mRNA CTD PMID:33167477 Siglec1 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of SIGLEC1 mRNA CTD PMID:35163327 Siglec1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of SIGLEC1 mRNA CTD PMID:30047161 Siglec1 Rat amphotericin B increases expression ISO SIGLEC1 (Homo sapiens) 6480464 Amphotericin B analog results in increased expression of SIGLEC1 mRNA CTD PMID:28534445 Siglec1 Rat antirheumatic drug decreases expression ISO SIGLEC1 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of SIGLEC1 mRNA CTD PMID:24449571 Siglec1 Rat arsane multiple interactions ISO SIGLEC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SIGLEC1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SIGLEC1 mRNA CTD PMID:39836092 Siglec1 Rat arsenic atom multiple interactions ISO SIGLEC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SIGLEC1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SIGLEC1 mRNA CTD PMID:39836092 Siglec1 Rat benzo[a]pyrene decreases expression ISO Siglec1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SIGLEC1 mRNA CTD PMID:22228805 Siglec1 Rat benzo[a]pyrene decreases expression ISO SIGLEC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SIGLEC1 mRNA CTD PMID:32234424 Siglec1 Rat benzo[a]pyrene affects methylation ISO SIGLEC1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SIGLEC1 3' UTR CTD PMID:27901495 Siglec1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SIGLEC1 mRNA CTD PMID:25181051 Siglec1 Rat bisphenol A increases expression ISO Siglec1 (Mus musculus) 6480464 bisphenol A results in increased expression of SIGLEC1 mRNA CTD PMID:38701888 Siglec1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in decreased expression of SIGLEC1 mRNA CTD PMID:31129395 Siglec1 Rat bisphenol F increases expression ISO Siglec1 (Mus musculus) 6480464 bisphenol F results in increased expression of SIGLEC1 mRNA CTD PMID:30951980 and PMID:38685157 Siglec1 Rat carbon nanotube decreases expression ISO Siglec1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Siglec1 Rat carbon nanotube increases expression ISO Siglec1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Siglec1 Rat clotrimazole decreases expression EXP 6480464 Clotrimazole results in decreased expression of SIGLEC1 mRNA CTD PMID:30047161 Siglec1 Rat coumarin decreases phosphorylation ISO SIGLEC1 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of SIGLEC1 protein CTD PMID:35688186 Siglec1 Rat D-glucose multiple interactions ISO Siglec1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of SIGLEC1 mRNA CTD PMID:37567420 Siglec1 Rat dichlorine increases expression ISO Siglec1 (Mus musculus) 6480464 Chlorine results in increased expression of SIGLEC1 mRNA CTD PMID:30189237 Siglec1 Rat dioxygen multiple interactions EXP 6480464 [dan-shen root extract co-treated with Andrographis paniculata extract] inhibits the reaction [[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of SIGLEC1 mRNA] and [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of SIGLEC1 mRNA CTD PMID:33729688 Siglec1 Rat fructose multiple interactions ISO Siglec1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of SIGLEC1 mRNA CTD PMID:37567420 Siglec1 Rat genistein decreases expression ISO Siglec1 (Mus musculus) 6480464 Genistein results in decreased expression of SIGLEC1 mRNA CTD PMID:32186404 Siglec1 Rat glucose multiple interactions ISO Siglec1 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of SIGLEC1 mRNA CTD PMID:37567420 Siglec1 Rat irinotecan multiple interactions ISO SIGLEC1 (Homo sapiens) 6480464 [Fluorouracil co-treated with Irinotecan] results in increased expression of SIGLEC1 mRNA CTD PMID:16391804 Siglec1 Rat manganese atom multiple interactions ISO SIGLEC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SIGLEC1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of SIGLEC1 mRNA CTD PMID:39836092 Siglec1 Rat manganese(0) multiple interactions ISO SIGLEC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SIGLEC1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of SIGLEC1 mRNA CTD PMID:39836092 Siglec1 Rat manganese(II) chloride multiple interactions ISO SIGLEC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SIGLEC1 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of SIGLEC1 mRNA CTD PMID:39836092 Siglec1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of SIGLEC1 mRNA CTD PMID:30047161 Siglec1 Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of SIGLEC1 mRNA CTD PMID:31378766 Siglec1 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of SIGLEC1 mRNA CTD PMID:28801915 Siglec1 Rat nickel atom increases expression ISO SIGLEC1 (Homo sapiens) 6480464 Nickel results in increased expression of SIGLEC1 mRNA CTD PMID:25583101 Siglec1 Rat O-methyleugenol decreases expression ISO SIGLEC1 (Homo sapiens) 6480464 methyleugenol results in decreased expression of SIGLEC1 mRNA CTD PMID:32234424 Siglec1 Rat ozone multiple interactions ISO Siglec1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of SIGLEC1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of SIGLEC1 mRNA CTD PMID:34911549 Siglec1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of SIGLEC1 mRNA CTD PMID:32680482 Siglec1 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of SIGLEC1 mRNA CTD PMID:32721576 Siglec1 Rat silver atom increases expression ISO Siglec1 (Mus musculus) 6480464 Silver results in increased expression of SIGLEC1 mRNA CTD PMID:27131904 Siglec1 Rat silver(0) increases expression ISO Siglec1 (Mus musculus) 6480464 Silver results in increased expression of SIGLEC1 mRNA CTD PMID:27131904 Siglec1 Rat sodium arsenite increases expression ISO SIGLEC1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SIGLEC1 mRNA CTD PMID:29301061 Siglec1 Rat sodium arsenite multiple interactions ISO SIGLEC1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of SIGLEC1 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of SIGLEC1 mRNA CTD PMID:39836092 Siglec1 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of SIGLEC1 mRNA CTD PMID:32741896 Siglec1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of SIGLEC1 mRNA CTD PMID:31150632 Siglec1 Rat Theaflavin 3,3'-digallate affects expression ISO SIGLEC1 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of SIGLEC1 mRNA CTD PMID:34925699 Siglec1 Rat titanium dioxide increases expression ISO Siglec1 (Mus musculus) 6480464 titanium dioxide results in increased expression of SIGLEC1 mRNA CTD PMID:29264374 and PMID:35295148 Siglec1 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of SIGLEC1 mRNA CTD PMID:30012374 Siglec1 Rat tributylstannane multiple interactions EXP 6480464 [bisphenol A co-treated with tributyltin] results in decreased expression of SIGLEC1 mRNA CTD PMID:31129395 Siglec1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of SIGLEC1 mRNA CTD PMID:33387578 Siglec1 Rat trimellitic anhydride decreases expression ISO Siglec1 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of SIGLEC1 mRNA CTD PMID:19042947 Siglec1 Rat triptonide increases expression ISO Siglec1 (Mus musculus) 6480464 triptonide results in increased expression of SIGLEC1 mRNA CTD PMID:33045310 Siglec1 Rat valproic acid increases methylation ISO SIGLEC1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SIGLEC1 gene CTD PMID:29154799 Siglec1 Rat zidovudine multiple interactions ISO SIGLEC1 (Homo sapiens) 6480464 [Zidovudine co-treated with IFNA1 protein] results in increased expression of SIGLEC1 mRNA CTD PMID:20370541
Siglec1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 138,740,171 - 138,759,966 (-) NCBI GRCr8 mRatBN7.2 3 118,287,988 - 118,307,125 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 118,287,988 - 118,306,850 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 122,182,321 - 122,201,175 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 130,781,499 - 130,800,293 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 128,438,431 - 128,457,285 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 123,612,067 - 123,631,718 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 123,612,067 - 123,631,109 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 130,111,340 - 130,130,084 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 118,769,404 - 118,787,908 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 118,676,987 - 118,692,769 (-) NCBI Celera 3 117,098,468 - 117,117,016 (-) NCBI Celera Cytogenetic Map 3 q36 NCBI
SIGLEC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 3,686,970 - 3,712,600 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 3,686,970 - 3,712,600 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 3,667,617 - 3,693,247 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 3,615,617 - 3,635,775 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 3,617,206 - 3,635,775 NCBI Celera 20 3,729,495 - 3,749,653 (-) NCBI Celera Cytogenetic Map 20 p13 NCBI HuRef 20 3,615,947 - 3,636,103 (-) NCBI HuRef CHM1_1 20 3,667,931 - 3,688,082 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 3,717,911 - 3,743,544 (-) NCBI T2T-CHM13v2.0
Siglec1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 130,911,140 - 130,928,697 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 130,911,140 - 130,928,685 (-) Ensembl GRCm39 Ensembl GRCm38 2 131,067,801 - 131,086,778 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 131,069,220 - 131,086,765 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 130,894,956 - 130,912,501 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 130,760,184 - 130,778,206 (-) NCBI MGSCv36 mm8 Celera 2 132,293,968 - 132,311,385 (-) NCBI Celera Cytogenetic Map 2 F1 NCBI cM Map 2 63.26 NCBI
Siglec1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 14,536,266 - 14,560,632 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 14,539,284 - 14,560,614 (-) NCBI ChiLan1.0 ChiLan1.0
SIGLEC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 4,650,680 - 4,679,583 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 4,647,500 - 4,676,408 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 3,769,118 - 3,795,678 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 3,526,791 - 3,551,070 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 20 3,526,791 - 3,552,309 (-) Ensembl panpan1.1 panPan2
SIGLEC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 17,636,143 - 17,667,791 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 17,636,026 - 17,666,854 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 17,465,992 - 17,496,959 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 18,055,099 - 18,086,072 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 18,055,165 - 18,080,168 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 17,649,935 - 17,680,868 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 17,761,270 - 17,792,416 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 18,088,684 - 18,119,668 (+) NCBI UU_Cfam_GSD_1.0
Siglec1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 166,542,946 - 166,568,774 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936485 14,979,819 - 14,998,004 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936485 14,979,838 - 14,999,047 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SIGLEC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 31,994,632 - 32,021,239 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 31,994,505 - 32,021,239 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 36,328,314 - 36,347,405 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SIGLEC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 34,371,605 - 34,417,105 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 34,371,519 - 34,392,034 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666071 10,057,143 - 10,078,848 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Siglec1
.
Predicted Target Of
Count of predictions: 170 Count of miRNA genes: 117 Interacting mature miRNAs: 136 Transcripts: ENSRNOT00000028855 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
2312673 Scl63 Serum cholesterol level QTL 63 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 3 98535255 168026850 Rat 2301414 Kidm37 Kidney mass QTL 37 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 70653097 121056321 Rat 2302373 Gluco39 Glucose level QTL 39 5.01 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 3 98535386 161695835 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 2292591 Esta4 Estrogen-induced thymic atrophy QTL 4 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 3 47233211 147415807 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 1581568 Rf53 Renal function QTL 53 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 3 56395968 161299569 Rat 7387306 Bw124 Body weight QTL 124 3.2 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 3 84091273 129091273 Rat 1578754 Stresp16 Stress response QTL 16 4 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 3 112681431 157681431 Rat 1300111 Rf12 Renal function QTL 12 3.78 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 3 61017749 121056321 Rat 1600376 Arunc5 Aerobic running capacity QTL 5 0.21 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 3 73376539 118376539 Rat 8694437 Bw167 Body weight QTL 167 22.46 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 3 91797474 136797474 Rat 8662816 Vetf4 Vascular elastic tissue fragility QTL 4 4 renal artery integrity trait (VT:0010642) number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563) 3 59242096 157323038 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 1354611 Despr2 Despair related QTL 2 3.03 0.0028 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 3 97084464 142084464 Rat 631649 Bp123 Blood pressure QTL 123 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 89772419 134772419 Rat 631841 Niddm39 Non-insulin dependent diabetes mellitus QTL 39 3.36 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 94856903 159898684 Rat 1358204 Insglur1 Insulin/glucose ratio QTL 1 3.8 blood glucose amount (VT:0000188) serum glucose level (CMO:0000543) 3 115638168 135181505 Rat 619618 Rf3 Renal disease susceptibility QTL 3 6.5 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate to body weight ratio (CMO:0001270) 3 107693393 152693393 Rat 12879848 Bw181 Body weght QTL 181 0.015 body mass (VT:0001259) body weight (CMO:0000012) 3 70348525 121056321 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 2312659 Slep7 Serum leptin concentration QTL 7 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 3 98535255 168026850 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 1581546 Pur13 Proteinuria QTL 13 2.93 0.0335 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 3 78196190 146592722 Rat 631665 Bw8 Body weight QTL 8 5.5 body mass (VT:0001259) body weight (CMO:0000012) 3 50437042 119183768 Rat 1331758 Bp207 Blood pressure QTL 207 2.848 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 112287552 135181505 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2293087 Iddm27 Insulin dependent diabetes mellitus QTL 27 2.68 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 97551417 147415807 Rat 2312670 Bw94 Body weight QTL 94 0.01 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 3 98535255 168026850 Rat 724532 Cm17 Cardiac mass QTL 17 2 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 3 95735366 140735366 Rat
Sn
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 138,750,383 - 138,750,906 (+) Marker Load Pipeline mRatBN7.2 3 118,297,352 - 118,297,875 (+) MAPPER mRatBN7.2 Rnor_6.0 3 123,621,432 - 123,621,954 NCBI Rnor6.0 Rnor_5.0 3 130,120,705 - 130,121,227 UniSTS Rnor5.0 RGSC_v3.4 3 118,778,769 - 118,779,291 UniSTS RGSC3.4 Celera 3 117,107,833 - 117,108,345 UniSTS Cytogenetic Map 3 q36 UniSTS
RH135254
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 3 138,742,040 - 138,742,241 (+) Marker Load Pipeline mRatBN7.2 3 118,289,009 - 118,289,210 (+) MAPPER mRatBN7.2 Rnor_6.0 3 123,613,089 - 123,613,289 NCBI Rnor6.0 Rnor_5.0 3 130,112,362 - 130,112,562 UniSTS Rnor5.0 RGSC_v3.4 3 118,770,426 - 118,770,626 UniSTS RGSC3.4 Celera 3 117,099,490 - 117,099,690 UniSTS RH 3.4 Map 3 1014.7 UniSTS Cytogenetic Map 3 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
103
89
88
57
25
57
6
216
97
83
45
59
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028855 ⟹ ENSRNOP00000028855
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 118,287,988 - 118,306,850 (-) Ensembl Rnor_6.0 Ensembl 3 123,612,067 - 123,630,929 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000091493 ⟹ ENSRNOP00000072470
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 118,287,988 - 118,306,850 (-) Ensembl Rnor_6.0 Ensembl 3 123,612,257 - 123,631,109 (-) Ensembl
RefSeq Acc Id:
NM_001107777 ⟹ NP_001101247
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,741,019 - 138,759,881 (-) NCBI mRatBN7.2 3 118,287,988 - 118,306,850 (-) NCBI Rnor_6.0 3 123,612,067 - 123,630,929 (-) NCBI Rnor_5.0 3 130,111,340 - 130,130,084 (-) NCBI RGSC_v3.4 3 118,769,404 - 118,787,908 (-) RGD Celera 3 117,098,468 - 117,117,016 (-) RGD
Sequence:
AGACAAGAGTTGGTCTAGAGTCTATGAAGCCTAGAGTCTATGAAGCCTAGAGTCTATGAAGCAGAGAGAAAGGGGACAACATAGGAGGTAAGAAATGGAGGTCTCTCAAAATCTCAGGGGCAACGAGG
hide sequence
RefSeq Acc Id:
XM_006235024 ⟹ XP_006235086
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,740,171 - 138,759,965 (-) NCBI mRatBN7.2 3 118,288,481 - 118,307,125 (-) NCBI Rnor_6.0 3 123,612,824 - 123,631,718 (-) NCBI Rnor_5.0 3 130,111,340 - 130,130,084 (-) NCBI
Sequence:
ATTTTTGTTGGTTTATTACTCAACATTTCCTCAATGAGAAGTGCCTATTCAAGTCCTTTGCCCG
hide sequence
RefSeq Acc Id:
XM_017591746 ⟹ XP_017447235
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,740,171 - 138,759,965 (-) NCBI mRatBN7.2 3 118,288,481 - 118,307,125 (-) NCBI Rnor_6.0 3 123,612,824 - 123,631,718 (-) NCBI
Sequence:
ATTTTTGTTGGTTTATTACTCAACATTTCCTCAATGAGAAGTGCCTATTCAAGTCCTTTGCCCGCTTTCCTGGTTGTTTTATTTCTGAGTAGGCGATGCCATTGCTAGAATTCTCTACATGTTCTGGT
hide sequence
RefSeq Acc Id:
XM_017591747 ⟹ XP_017447236
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,740,171 - 138,759,966 (-) NCBI mRatBN7.2 3 118,288,481 - 118,307,125 (-) NCBI Rnor_6.0 3 123,612,824 - 123,631,718 (-) NCBI
Sequence:
ATTTTTGTTGGTTTATTACTCAACATTTCCTCAATGAGAAGTGCCTATTCAAGTCCTTTGCCCG
hide sequence
RefSeq Acc Id:
XM_017591748 ⟹ XP_017447237
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,740,171 - 138,759,965 (-) NCBI mRatBN7.2 3 118,288,481 - 118,307,124 (-) NCBI Rnor_6.0 3 123,612,824 - 123,631,718 (-) NCBI
Sequence:
ATTTTTGTTGGTTTATTACTCAACATTTCCTCAATGAGAAGTGCCTATTCAAGTCCTTTGCCCGCTTTCCTGGTTGTTTTATTTCTGAGTAGGCGATGCCATTGCTAGAATTCTCTACATGTTCTGGT
hide sequence
RefSeq Acc Id:
XM_017591749 ⟹ XP_017447238
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 138,740,171 - 138,759,965 (-) NCBI mRatBN7.2 3 118,288,481 - 118,307,125 (-) NCBI Rnor_6.0 3 123,612,824 - 123,631,718 (-) NCBI
Sequence:
ATTTTTGTTGGTTTATTACTCAACATTTCCTCAATGAGAAGTGCCTATTCAAGTCCTTTGCCCGCTTTCCTGGTTGTTTTATTTCTGAGTAGGCGATGCCATTGCTAGAATTCTCTACATGTTCTGGT
hide sequence
RefSeq Acc Id:
NP_001101247 ⟸ NM_001107777
- Peptide Label:
precursor
- UniProtKB:
D3ZVM6 (UniProtKB/TrEMBL), A6HQC1 (UniProtKB/TrEMBL), A0A0G2K320 (UniProtKB/TrEMBL)
- Sequence:
MCALLSLLLLASVFTPGQTTWGVSSPKDVQGLTGSCLLIPCIFSFPADVSVPNGITAIWYYDYSGKRQVVIHSGDPKLVDERFRGRAELTGNMDHKVCNLLLKDLKLEDSGTYNFRFEISDGNRWSDV
hide sequence
RefSeq Acc Id:
XP_006235086 ⟸ XM_006235024
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K320 (UniProtKB/TrEMBL)
- Sequence:
MCALLSLLLLASVFTPGQTTWGVSSPKDVQGLTGSCLLIPCIFSFPADVSVPNGITAIWYYDYSGKRQVVIHSGDPKLVDERFRGRAELTGNMDHKVCNLLLKDLKLEDSGTYNFRFEISDGNRWSDV
hide sequence
RefSeq Acc Id:
XP_017447237 ⟸ XM_017591748
- Peptide Label:
isoform X4
- UniProtKB:
A0A0G2K320 (UniProtKB/TrEMBL)
- Sequence:
MCALLSLLLLASVFTPGQTTWGVSSPKDVQGLTGSCLLIPCIFSFPADVSVPNGITAIWYYDYS
hide sequence
RefSeq Acc Id:
XP_017447235 ⟸ XM_017591746
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2K320 (UniProtKB/TrEMBL)
- Sequence:
MCALLSLLLLASVFTPGQTTWGVSSPKDVQGLTGSCLLIPCIFSFPADVSVPNGITAIWYYDYSGKRQVVIHSGDPKLVDERFRGRAELTGNMDHKVCNLLLKDLKLEDSGTYNFRFEISDGNRWSDV
hide sequence
RefSeq Acc Id:
XP_017447238 ⟸ XM_017591749
- Peptide Label:
isoform X5
- UniProtKB:
A0A0G2K320 (UniProtKB/TrEMBL)
- Sequence:
MCALLSLLLLASVFTPGQTTWGVSSPKDVQGLTGSCLLIPCIFSFPADVSVPNGITAIWYYDYS
hide sequence
RefSeq Acc Id:
XP_017447236 ⟸ XM_017591747
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K320 (UniProtKB/TrEMBL)
- Sequence:
MCALLSLLLLASVFTPGQTTWGVSSPKDVQGLTGSCLLIPCIFSFPADVSVPNGITAIWYYDYSGKRQVVIHSGDPKLVDERFRGRAELTGNMDHKVCNLLLKDLKLEDSGTYNFRFEISDGNRWSDV
hide sequence
Ensembl Acc Id:
ENSRNOP00000028855 ⟸ ENSRNOT00000028855
Ensembl Acc Id:
ENSRNOP00000072470 ⟸ ENSRNOT00000091493
RGD ID: 13692443 Promoter ID: EPDNEW_R2968 Type: single initiation site Name: Siglec1_1 Description: sialic acid binding Ig like lectin 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 123,630,399 - 123,630,459 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-27
Siglec1
sialic acid binding Ig like lectin 1
Siglec1
sialic acid binding Ig-like lectin 1, sialoadhesin
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Siglec1
sialic acid binding Ig-like lectin 1, sialoadhesin
Siglec1_predicted
sialic acid binding Ig-like lectin 1, sialoadhesin (predicted)
'predicted' is removed
2292626 APPROVED
2008-01-09
Siglec1_predicted
sialic acid binding Ig-like lectin 1, sialoadhesin (predicted)
LOC688116
similar to sialoadhesin
Data merged from RGD:1592443
1643240 APPROVED
2006-11-20
LOC688116
similar to sialoadhesin
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-03-30
Siglec1_predicted
sialic acid binding Ig-like lectin 1, sialoadhesin (predicted)
Sn_predicted
sialoadhesin (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-12
Sn_predicted
sialoadhesin (predicted)
Symbol and Name status set to approved
70820 APPROVED
